FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: AXA82_HUMAN (Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8L2 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 8.349e-20
Identity = 69/212 (32.55%), Postives = 104/212 (49.06%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L+KA +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  SLEED+   TSG   ++LV L+   R D    V+  LA  +A+ +    + I   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPALALQDAQDLYAAGENIRGTD--EMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: AXA81_HUMAN (Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8L1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.090e-19
Identity = 69/212 (32.55%), Postives = 105/212 (49.53%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYD-GGDVNMMLARTEAKII---RDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            DAE L++A +G GTNE  II VL  R+  QR+ I + +   +G+DL + L  ELS  FER ++     P   +A   ++A K L +   V++EI  +R+   L    +AY   Y  SLEED+   TSG   ++LV L+   R D    V+  LA  +A+ +    +KI   D    + I IL TRS   +      Y      +    +K++
Sbjct:   26 DAETLYQAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTD--EMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSE 235          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_CHICK (Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.090e-19
Identity = 67/198 (33.84%), Postives = 103/198 (52.02%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAE-RDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            A  DAE L KA +G GT+E  I+ +L  RN AQR+ I   +   +G DL+  L  EL+  FE ++++  + PA   DA+    A K   ++  VL EI  +R+  ++   KQ Y   Y+ +LE+ +   TSG F++LLV L+   R   G V+  L   +A+++      K    EE  I IL TRS + +    + Y
Sbjct:   17 ARADAEALRKAMKGMGTDEETILKILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFE-TLMVSLMRPARIFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLEDKITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKDAQVLFRAGELKWGTDEETFITILGTRSVSHLRRVFDKY 213          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_RAT (Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.090e-19
Identity = 68/203 (33.50%), Postives = 98/203 (48.28%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHY 673
            P+  PS+  D   LHKA    G +EA II +L  R  AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  TRS++ +    + Y    K+ L +D+   TSGDFR  L+ L    R +   VN  LA T+A+ + +    +      +   ILTTRS   +     +Y
Sbjct:   40 PSFNPSS--DVAALHKAIMVKGVDEATIIDILTKRTNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLAMLKTPAQFDADELRAAMKGLGTDEDTLIEILTTRSNQQIREITRVYREELKRDLAKDITSDTSGDFRNALLALAKGDRCEDMSVNQDLADTDARALYEAGERRKGTDVNVFNTILTTRSYPHLRKVFQNY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX10_MOUSE (Annexin A10 OS=Mus musculus GN=Anxa10 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.173e-19
Identity = 59/199 (29.65%), Postives = 103/199 (51.76%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIR-ILTTRSKAQINATLNHYNDAFG 688
            DA+ L    QG+  N+ ++I +L  R+ AQR++I   Y   YG DL+  L ++LSS F+  ++     P   DA+    A K   +    L+EI  +R++ ++F  ++AY  +Y  +L+ED+   TSG FR  L+ LV   R +G     M A+ +A ++ +    K   H+ +++ IL  +S  Q+      + +  G
Sbjct:   22 DAQMLGGRLQGFDCNKDMLIDILTQRSNAQRQMIAGTYQSMYGRDLISVLKEQLSSHFKEVMVGLMYPPPSYDAHELWHAMKGPGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQANREEGYSDPAMAAQ-DAMVLWEACQQKTGEHKTMMQMILCNKSYPQLRLVFQEFQNISG 219          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_CYNPY (Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.143e-19
Identity = 68/211 (32.23%), Postives = 105/211 (49.76%), Query Frame = 2
Query:   92 EDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAER-DAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            EDAE L  A +G GT+E  I+ +L  R+  QR+ I   Y   +G DL   L  ELS  FE ++L+  + PA   DA     A K L +   V++EI  +R++ ++   K+ Y   +   LE+D+   TSG+F +LLV LV   R   G V+      +AK + D   +K    EE  I IL+TR    +    + Y    G    + ++++
Sbjct:   21 EDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFE-TLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSE 230          

HSP 2 Score: 75.485 bits (184), Expect = 3.397e-13
Identity = 64/235 (27.23%), Postives = 105/235 (44.68%), Query Frame = 2
Query:   56 TLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERD-------AYLANEATKRLTS--SNW-----VLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            TL V    P+   DA +L  A +G GT E +II ++A R AA+ K I+E Y + +  DL K +  + S +FER  LL +L  A RD         + N+A     +  + W       + I  TR    L      Y       +EE +   T G F KLL+ +V + R   G +        A+++ + +       + LIR+L +RS+  +      +   +G + H  +++D
Sbjct:   81 TLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFER--LLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYL--------AEVLYNSMKGAGTDDQTLIRVLVSRSEIDLFNIRQTFRKHYGKSLHAMIQSD 305          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_PANTR (Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3)

HSP 1 Score: 94.7449 bits (234), Expect = 5.412e-19
Identity = 64/194 (32.99%), Postives = 96/194 (49.48%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            DAE L KA +G GT+E  I+++L  R+ AQR+ I   +   +G DLL  L  EL+  FE+ ++         DAY    A K   ++  VL EI  +R+  +L A KQ Y   Y  SLE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I I  TRS + +    + Y
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKY 213          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_HUMAN (Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 5.412e-19
Identity = 64/194 (32.99%), Postives = 96/194 (49.48%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            DAE L KA +G GT+E  I+++L  R+ AQR+ I   +   +G DLL  L  EL+  FE+ ++         DAY    A K   ++  VL EI  +R+  +L A KQ Y   Y  SLE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I I  TRS + +    + Y
Sbjct:   20 DAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKY 213          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA1_MOUSE (Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 7.068e-19
Identity = 69/207 (33.33%), Postives = 98/207 (47.34%), Query Frame = 2
Query:   68 PTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKII-----RDKISDKDYAHEELIRILTTRSKAQINATLNHY 673
            P  + + + D   LHKA    G +EA II +L  R  AQR+ I+  Y +  G+ L + L K L+   E  VL    TPA+ DA     A K L +    L+EI  TRS+  +    + Y    K+ L +D+   TSGDFRK L+ L    R     VN  LA T+A+ +     R K +D +        ILT+RS   +     +Y
Sbjct:   38 PYPSFNVSSDVAALHKAIMVKGVDEATIIDILTKRTNAQRQQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDADELRGAMKGLGTDEDTLIEILTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFRKALLALAKGDRCQDLSVNQDLADTDARALYEAGERRKGTDVNV----FTTILTSRSFPHLRRVFQNY 240          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA5_RAT (Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3)

HSP 1 Score: 93.9745 bits (232), Expect = 9.231e-19
Identity = 64/194 (32.99%), Postives = 98/194 (50.52%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHY 673
            DAE L KA +G GT+E  I+++L  R+ AQR+ I E +   +G DL+  +  EL+  FE+ ++         DAY    A K   +   VL EI  +R+  +L A KQAY   Y  +LE+DV   TSG ++++LV L+   R     ++      +A+ +      K    EE  I IL TRS + +    + Y
Sbjct:   18 DAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKY 211          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
AXA82_HUMAN8.349e-2032.55Annexin A8-like protein 2 OS=Homo sapiens GN=ANXA8... [more]
AXA81_HUMAN1.090e-1932.55Annexin A8-like protein 1 OS=Homo sapiens GN=ANXA8... [more]
ANXA5_CHICK1.090e-1933.84Annexin A5 OS=Gallus gallus GN=ANXA5 PE=1 SV=2[more]
ANXA1_RAT1.090e-1933.50Annexin A1 OS=Rattus norvegicus GN=Anxa1 PE=1 SV=2[more]
ANX10_MOUSE3.173e-1929.65Annexin A10 OS=Mus musculus GN=Anxa10 PE=2 SV=1[more]
ANXA5_CYNPY4.143e-1932.23Annexin A5 OS=Cynops pyrrhogaster PE=2 SV=1[more]
ANXA5_PANTR5.412e-1932.99Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3[more]
ANXA5_HUMAN5.412e-1932.99Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2[more]
ANXA1_MOUSE7.068e-1933.33Annexin A1 OS=Mus musculus GN=Anxa1 PE=1 SV=2[more]
ANXA5_RAT9.231e-1932.99Annexin A5 OS=Rattus norvegicus GN=Anxa5 PE=1 SV=3[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top