FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_CEREL (Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.274e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKXKXTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_SHEEP (Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.969e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_BOVIN (Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.969e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIVSDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_PIG (Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4)

HSP 1 Score: 88.5817 bits (218), Expect = 3.878e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_CANFA (Annexin A2 OS=Canis familiaris GN=ANXA2 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.878e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX2A_XENLA (Annexin A2-A OS=Xenopus laevis GN=anxa2-A PE=2 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 3.878e-17
Identity = 64/213 (30.05%), Postives = 102/213 (47.89%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDV--NMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHY 673
            +S + T+K  T    A +DA  +  A +  G +E  II++L +R+  QR+ I   Y+    +DL  AL   LS + E  +L    T  + DA     + K L +    L+EI C+R++++L   + AY   YK  LE+D+   TSGDFRKL+V L    R + G V     + +   ++    +  K     + I I+T RS   +      Y
Sbjct:   22 QSALGTVKASTNF-DAEKDAAAIETAIKTKGVDELTIINILTNRSNDQRQDIAFAYHRRTKKDLASALKGALSGNLETVMLGLIKTRPQYDASELKASMKGLGTDEDTLIEIICSRTNKELLDIQNAYRELYKTELEKDIVSDTSGDFRKLMVALAKGKRQEEGSVVDYEKIDQDARELYEAGVKRKGTDVGKWITIMTERSTPHLQKVFERY 233          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX12_COLLI (Annexin A1 isoform p37 OS=Columba livia GN=CP37 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.878e-17
Identity = 65/214 (30.37%), Postives = 99/214 (46.26%), Query Frame = 2
Query:   41 KSTMATLKVPTQTPS--AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEEL-IRILTTRSKAQINATLNHY 673
            KS      VP Q P+   + D   L KA    G +EA II ++  R  AQR  I+  Y +  G+ L +A+ + L S  E  V+    TPA+ DA       K L +    L+EI  +RS++++  A + Y    K+ L +D+   TSG F+K LV L    R +   VN  LA  +A+ + +    K      + + +LT RS   +      Y
Sbjct:   23 KSVKGGPVVPQQQPNFDPSADVVALEKAMTAKGVDEATIIDIMTKRTNAQRHRIKAAYQKAKGKSLEEAMKRVLKSHLEDVVVALLKTPAQFDAEELRACMKGLGTDEDTLIEILASRSNKEIREASRYYKEVLKRDLTQDIISDTSGHFQKALVVLAKGDRCEDPHVNDDLADNDARALYEAGEQKKGTDVNVFVTVLTARSYPHLRRVFQKY 236          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: AXA2L_HUMAN (Putative annexin A2-like protein OS=Homo sapiens GN=ANXA2P2 PE=5 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.615e-17
Identity = 62/198 (31.31%), Postives = 98/198 (49.49%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I++++ +R+ AQR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +    + Y
Sbjct:   35 AERDALNIETAIKTKGVDEVTIVNIVTNRDNAQRQDIVFSYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDAQDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_MOUSE (Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.615e-17
Identity = 62/198 (31.31%), Postives = 96/198 (48.48%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            A  DA  +  A +  G +E  I+++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TPA+ DA     + K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  DG  ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   35 AERDALNIETAVKTKGVDEVTIVNILTNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERY 232          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXA2_CHICK (Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 6.615e-17
Identity = 67/212 (31.60%), Postives = 101/212 (47.64%), Query Frame = 2
Query:   44 STMATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFR-YDGGDVNMMLARTEAKIIRDK-ISDKDYAHEELIRILTTRSKAQINATLNHY 673
            S  AT+K  +    A  DA  L  A +  G +E  II++L +R+  QR+ I   Y     ++L  AL   LS   E  +L    TP++ DA     A K L +    L+EI C+R++++L    + Y   YK  LE+D+   TSGDFRKL+V L    R  D   ++  L   +A+ + D  +  K     + I I+T RS   +      Y
Sbjct:   22 SAYATVKAYSNF-DADRDAAALEAAIKTKGVDEVTIINILTNRSNEQRQDIAFAYQRRTKKELSAALKSALSGHLEAVILGLLKTPSQYDASELKAAMKGLGTDEDTLIEIICSRTNQELNEINRVYREMYKTELEKDIISDTSGDFRKLMVALAKGKRCEDTSVIDYELIDQDARELYDAGVKRKGTDVPKWINIMTERSVPHLQKVFERY 232          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXA2_CEREL2.274e-1731.31Annexin A2 OS=Cervus elaphus GN=ANXA2 PE=2 SV=1[more]
ANXA2_SHEEP2.969e-1731.31Annexin A2 OS=Ovis aries GN=ANXA2 PE=1 SV=1[more]
ANXA2_BOVIN2.969e-1731.31Annexin A2 OS=Bos taurus GN=ANXA2 PE=1 SV=2[more]
ANXA2_PIG3.878e-1731.31Annexin A2 OS=Sus scrofa GN=ANXA2 PE=1 SV=4[more]
ANXA2_CANFA3.878e-1731.31Annexin A2 OS=Canis familiaris GN=ANXA2 PE=1 SV=1[more]
ANX2A_XENLA3.878e-1730.05Annexin A2-A OS=Xenopus laevis GN=anxa2-A PE=2 SV=... [more]
ANX12_COLLI3.878e-1730.37Annexin A1 isoform p37 OS=Columba livia GN=CP37 PE... [more]
AXA2L_HUMAN6.615e-1731.31Putative annexin A2-like protein OS=Homo sapiens G... [more]
ANXA2_MOUSE6.615e-1731.31Annexin A2 OS=Mus musculus GN=Anxa2 PE=1 SV=2[more]
ANXA2_CHICK6.615e-1731.60Annexin A2 OS=Gallus gallus GN=ANXA2 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top