FC920925

Overview
NameFC920925
Unique NameFC920925
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14215 contig Ccv1_Contig14215:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: HAOX2_MOUSE (Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.243e-30
Identity = 76/163 (46.63%), Postives = 102/163 (62.58%), Query Frame = 1
Query:  187 LNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            L +F+  A+  L K  +DF  G A+D  T  +N+ AF RI  RPR L DVS+ID  TTI   +I+API I+PTAFH +A  +GE +TA+AA   N   V+S  +S T+E+ VAA+   + ++QLYV    DI   +VQR E  GFKALV+T D P LG R  +
Sbjct:    6 LADFKAQAQKQLSKTSWDFIEGEADDGITYNDNLAAFRRIRLRPRYLRDVSKIDTRTTIQGQEINAPICISPTAFHSIAWADGEKSTAKAAQKANICYVISSYASYTVEDIVAAAPGGLHWFQLYVQPDWDINKQMVQRIEALGFKALVVTVDAPVLGNRRGN 168          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: CYB2_YEAST (Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae GN=CYB2 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.795e-29
Identity = 75/174 (43.10%), Postives = 101/174 (58.05%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANP-EGEVATARAAASCNT-----IMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            +NL +F+ LA   L K  + +Y+ GA DE T +EN  A+HRI F+P+ILVDV ++D+ST +L   +  P  ++ TA  KL NP EGE   AR      T     I  L+  S   I E A S   +++YQLYV   R IT  LV+  E+ G KAL +T D P LG+RE D+K K
Sbjct:  203 INLYDFEYLASQTLTKQAWAYYSSGANDEVTHRENHNAYHRIFFKPKILVDVRKVDISTDMLGSHVDVPFYVSATALCKLGNPLEGEKDVARGCGQGVTKVPQMISTLASCSPEEIIEAAPSDKQIQWYQLYVNSDRKITDDLVKNVEKLGVKALFVTVDAPSLGQREKDMKLK 376          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: MDLB_PSEPU ((S)-mandelate dehydrogenase OS=Pseudomonas putida GN=mdlB PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.422e-26
Identity = 66/173 (38.15%), Postives = 101/173 (58.38%), Query Frame = 1
Query:  166 MAAEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKNK 684
            M+    N+ ++++L +  LPKM YD+  GGAEDE+ +K N + F +  F+P+ LVDVSR  L   +L  + S P++I PT  +    P+G++A ARAA       VLS  S+ +IE++A   +   ++QLYV   R+I   +V +A   G+  LVLT D    G RE D+ N+
Sbjct:    1 MSQNLFNVEDYRKLRQKRLPKMVYDYLEGGAEDEYGVKHNRDVFQQWRFKPKRLVDVSRRSLQAEVLGKRQSMPLLIGPTGLNGALWPKGDLALARAATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVI-HREIAQGMVLKALHTGYTTLVLTTDVAVNGYRERDLHNR 172          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_AGRVS (L-lactate dehydrogenase [cytochrome] OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lldD PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.304e-23
Identity = 57/160 (35.62%), Postives = 86/160 (53.75%), Query Frame = 1
Query:  193 EFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            +++E AR  LP   + +  GGA  EHT++ N++    +  R R+L  V  +D+STT+ D +++ P+++AP     +    GEV  ARAA      + LS  S   IEEV A+SN   ++QLYV + R      ++RA   G + LV T D P  G R  D
Sbjct:    8 DYREAARRRLPPFLFHYIDGGAYSEHTMRRNIDDLADLALRQRVLKSVGTVDISTTLFDEELAMPVVLAPVGLTGMYARRGEVQAARAAEKKGIPLTLSTVSVCPIEEVQAASNRPIWFQLYVLRDRGFMKNALERAWAAGIRKLVFTVDMPVPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD2_MYCTU (Putative L-lactate dehydrogenase [cytochrome] 2 OS=Mycobacterium tuberculosis GN=lldD2 PE=3 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 3.069e-21
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 1
Query:  181 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADIKN 681
            + + + + +A+   P+  +D+  GGAEDE ++    + F  I F P IL DV+ +     +L      P  IAPT F +L + EGE+A ARAAA+      LS  ++  IE+ V A     +++QLY+++ RD +  LV+R    GF  +++T D P  G R  D++N
Sbjct:   35 LTIQDLRRIAKRRTPRAAFDYADGGAEDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAGFDTMLVTVDVPVAGARLRDVRN 202          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_PSEU2 (L-lactate dehydrogenase [cytochrome] OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lldD PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.008e-21
Identity = 57/161 (35.40%), Postives = 85/161 (52.80%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP+  +D+  GGA  EHTL+ N      I+ R R+L +V  + L T +    ++ PII++P     +    GEV  ARAAA+      LS  S  +IEEVA+ S+   ++QLYV K R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAKRKLPRFLFDYIDGGAYAEHTLRANGSDLADISLRQRVLKNVDNVSLETRLFGESLAMPIILSPVGLSGMYARRGEVQVARAAANKRIPFCLSTVSVCSIEEVASQSDQAIWFQLYVLKDRGFMKNALERAKAAGVTTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_PSEFS (L-lactate dehydrogenase [cytochrome] OS=Pseudomonas fluorescens (strain SBW25) GN=lldD PE=3 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 5.234e-21
Identity = 56/161 (34.78%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP+  +D+  GGA  EHT++ N      I+ R RIL +V  + L TT+   ++  P+I++P     +    GEV  A+AAA+      LS  S   IEEVA+ S    ++QLYV K R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRKLPRFLFDYIDGGAYAEHTMRANSSDLAEISLRQRILRNVDNLSLKTTVFGQELDMPVILSPVGLTGMYARRGEVQAAKAAANKGVPFCLSTVSVCPIEEVASQSARAIWFQLYVLKDRGFMRNALERAQAAGVTTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_CAUSK (L-lactate dehydrogenase [cytochrome] OS=Caulobacter sp. (strain K31) GN=lldD PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.836e-21
Identity = 60/160 (37.50%), Postives = 84/160 (52.50%), Query Frame = 1
Query:  193 EFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            +F+E AR  LP+  +D+  GGA  E TL  NV     I+ R R+L DVSR+   TT+   + + P+ +AP     +    GEV  ARAAA+      LS  S   + EV+ +S+A  ++QLY+ + R     L+ RA   G  ALV T D P  G R  D
Sbjct:    8 DFREAARRQLPRFLFDYIDGGAYAERTLARNVSDLADISLRQRVLKDVSRVSTRTTLFGVEQTLPVALAPVGLTGMYARRGEVQAARAAAAKGVPFCLSTVSVCDLAEVSRASSAPIWFQLYMLRDRGFMRDLLARAADAGATALVFTVDMPVPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_PSEPK (L-lactate dehydrogenase [cytochrome] OS=Pseudomonas putida (strain KT2440) GN=lldD PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 8.928e-21
Identity = 58/160 (36.25%), Postives = 82/160 (51.25%), Query Frame = 1
Query:  193 EFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            +++  A+  LP   + +  GGA  EHTL+ NV     I  R R+L ++S + L T + D  +S P+ +AP     +    GEV  ARAAA+      +S  S   IEEVA + N   ++QLYV K R      ++RA+  G K LV T D P  G R  D
Sbjct:    8 DYRAAAQRKLPPFLFHYADGGAYAEHTLRHNVSDLAGIALRQRVLNNMSELSLETKLFDETLSMPVALAPVGLTGMYARRGEVQAARAAAAHGIPFTMSTVSVCPIEEVAPAINRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPVPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_PSEPG (L-lactate dehydrogenase [cytochrome] OS=Pseudomonas putida (strain GB-1) GN=lldD PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 8.928e-21
Identity = 58/160 (36.25%), Postives = 83/160 (51.88%), Query Frame = 1
Query:  193 EFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            +++  A+  LP   + +  GGA  EHTL+ NV     I  R R+L ++S + LST + D  +S P+ +AP     +    GEV  ARAAA+      +S  S   IEEVA + +   ++QLYV K R      ++RA+  G K LV T D P  G R  D
Sbjct:    8 DYRAAAQRKLPPFLFHYADGGAYAEHTLRHNVSDLASIALRQRVLNNMSELSLSTRLFDETLSMPVALAPVGLTGMYARRGEVQAARAAAAHGIPFTMSTVSVCPIEEVAPAIDRPMWFQLYVLKDRGFMRNALERAKAAGVKTLVFTVDMPVPGARYRD 167          
The following BLAST results are available for this feature:
BLAST of FC920925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
HAOX2_MOUSE1.243e-3046.63Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=2... [more]
CYB2_YEAST1.795e-2943.10Cytochrome b2, mitochondrial OS=Saccharomyces cere... [more]
MDLB_PSEPU1.422e-2638.15(S)-mandelate dehydrogenase OS=Pseudomonas putida ... [more]
LLDD_AGRVS7.304e-2335.63L-lactate dehydrogenase [cytochrome] OS=Agrobacter... [more]
LLDD2_MYCTU3.069e-2133.93Putative L-lactate dehydrogenase [cytochrome] 2 OS... [more]
LLDD_PSEU24.008e-2135.40L-lactate dehydrogenase [cytochrome] OS=Pseudomona... [more]
LLDD_PSEFS5.234e-2134.78L-lactate dehydrogenase [cytochrome] OS=Pseudomona... [more]
LLDD_CAUSK6.836e-2137.50L-lactate dehydrogenase [cytochrome] OS=Caulobacte... [more]
LLDD_PSEPK8.928e-2136.25L-lactate dehydrogenase [cytochrome] OS=Pseudomona... [more]
LLDD_PSEPG8.928e-2136.25L-lactate dehydrogenase [cytochrome] OS=Pseudomona... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H05EF RVDevelop1 Citrus clementina cDNA clone C32014H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920925 ID=FC920925|Name=FC920925|organism=Citrus clementina|type=EST|length=698bp
ACTAATCCTTTATACGCTTCTTGACTTTAACTCTGCCCCCGACTCACTGT
TGTAATCTGCTTCACGATCGACCTTCATCAGTTGAAATTTTTAGTCATTC
GGGTTCATTTCTTTACAAAATTCTATTGTTTAAGTTTGATTAATAGTTAT
TCGAATCGGTTTCACATGGCAGCTGAACCTGTTAATTTGAATGAGTTCCA
AGAATTGGCAAGGCTGGCCCTTCCAAAAATGTATTATGATTTCTACGCTG
GTGGAGCAGAAGATGAACATACCCTAAAAGAGAATGTGGAAGCCTTTCAT
AGAATTACGTTTCGGCCAAGAATTCTTGTCGATGTCAGCAGAATAGATTT
ATCGACTACTATACTTGATTACAAAATCTCGGCTCCCATTATCATTGCTC
CAACGGCTTTCCATAAGCTTGCAAACCCTGAAGGAGAAGTAGCCACAGCC
AGAGCAGCAGCTTCATGTAACACCATAATGGTTTTATCCTTCACATCTAG
CAGCACCATAGAGGAGGTTGCGGCCAGCTCCAATGCTGTTCGCTTCTATC
AATTATATGTATTCAAGAAACGAGATATAACAGCTACTCTAGTGCAGAGA
GCTGAAAGGAATGGTTTTAAGGCTCTTGTCCTAACTGCTGATACTCCAAG
ACTTGGTAGAAGGGAGGCAGATATAAAGAACAAATGATTACACGCCGT
back to top