FC920925

Overview
NameFC920925
Unique NameFC920925
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14215 contig Ccv1_Contig14215:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_ECOK1 (L-lactate dehydrogenase [cytochrome] OS=Escherichia coli O1:K1 / APEC GN=lldD PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE    +  R RIL ++S + L TT+ + K+S P+ + P     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALGPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_ECO81 (L-lactate dehydrogenase [cytochrome] OS=Escherichia coli O81 (strain ED1a) GN=lldD PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE    +  R RIL ++S + L TT+ + K+S P+ + P     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALGPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_ECO7I (L-lactate dehydrogenase [cytochrome] OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lldD PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE    +  R RIL ++S + L TT+ + K+S P+ + P     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALGPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_ECO45 (L-lactate dehydrogenase [cytochrome] OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lldD PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.872e-19
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE    +  R RIL ++S + L TT+ + K+S P+ + P     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALGPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_ESCF3 (L-lactate dehydrogenase [cytochrome] OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lldD PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.899e-19
Identity = 54/161 (33.54%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE   ++  R R+L ++S + L TT+ + K+S P+ +AP     +    GEV  A AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSQVALRQRVLKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAGAADAHGIPFTLSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_CITK8 (L-lactate dehydrogenase [cytochrome] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lldD PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.899e-19
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  E+TL+ NVE    +  R R+L ++S + L TT+ + K+S P+ +AP     +    GEV  A AA +      LS  S   IEEVA +     ++QLYV + R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSEVALRQRVLKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFTLSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_XANC5 (L-lactate dehydrogenase [cytochrome] OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lldD PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.398e-19
Identity = 55/161 (34.16%), Postives = 81/161 (50.31%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREAD 672
            ++++  A+  LP   + +  GGA  EHTL+ NV     +  R R+L ++S + LST +    ++ P+ +AP     +    GEV  ARAAA+      LS  S   IEEVA +     ++QLYV K R      ++RA+  G   LV T D P  G R  D
Sbjct:    7 SDYRAAAQARLPPFLFHYIDGGAYAEHTLRRNVSDLADVALRQRVLRNMSDLRLSTELFGETLAMPVALAPVGLTGMYARRGEVQAARAAAARGIPFTLSTVSVCPIEEVAPAIERPMWFQLYVLKDRGFMRNALERAKAAGVTTLVFTVDMPTPGARYRD 167          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_HAEIN (L-lactate dehydrogenase [cytochrome] OS=Haemophilus influenzae GN=lldD PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.398e-19
Identity = 56/162 (34.57%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADI 675
            ++++E AR  +P   + +  GG+  E TL  NV     I  R R+L D+S +D S  +   K+S P I+AP     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV K R      ++RA+  G   LV T D P  G R  D+
Sbjct:    7 SDYREAARRRVPPFMFHYADGGSYAEQTLARNVSDLENIALRQRVLKDMSELDTSIELFGEKLSMPTILAPVGACGMYARRGEVQAAQAADNKGVPFTLSTVSICPIEEVAPAIKRPMWFQLYVLKDRGFMKNALERAKAAGCSTLVFTVDMPTPGARYRDM 168          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_HAEIG (L-lactate dehydrogenase [cytochrome] OS=Haemophilus influenzae (strain PittGG) GN=lldD PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.398e-19
Identity = 56/162 (34.57%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADI 675
            ++++E AR  +P   + +  GG+  E TL  NV     I  R R+L D+S +D S  +   K+S P I+AP     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV K R      ++RA+  G   LV T D P  G R  D+
Sbjct:    7 SDYREAARRRVPPFMFHYADGGSYAEQTLARNVSDLENIALRQRVLKDMSELDTSIELFGEKLSMPTILAPVGACGMYARRGEVQAAQAADNKGVPFTLSTVSICPIEEVAPAIKRPMWFQLYVLKDRGFMKNALERAKAAGCSTLVFTVDMPTPGARYRDM 168          
BLAST of FC920925 vs. ExPASy Swiss-Prot
Match: LLDD_HAEIE (L-lactate dehydrogenase [cytochrome] OS=Haemophilus influenzae (strain PittEE) GN=lldD PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.398e-19
Identity = 56/162 (34.57%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  190 NEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTAFHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRFYQLYVFKKRDITATLVQRAERNGFKALVLTADTPRLGRREADI 675
            ++++E AR  +P   + +  GG+  E TL  NV     I  R R+L D+S +D S  +   K+S P I+AP     +    GEV  A+AA +      LS  S   IEEVA +     ++QLYV K R      ++RA+  G   LV T D P  G R  D+
Sbjct:    7 SDYREAARRRVPPFMFHYADGGSYAEQTLARNVSDLENIALRQRVLKDMSELDTSIELFGEKLSMPTILAPVGACGMYARRGEVQAAQAADNKGVPFTLSTVSICPIEEVAPAIKRPMWFQLYVLKDRGFMKNALERAKAAGCSTLVFTVDMPTPGARYRDM 168          
The following BLAST results are available for this feature:
BLAST of FC920925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
LLDD_ECOK12.872e-1933.54L-lactate dehydrogenase [cytochrome] OS=Escherichi... [more]
LLDD_ECO812.872e-1933.54L-lactate dehydrogenase [cytochrome] OS=Escherichi... [more]
LLDD_ECO7I2.872e-1933.54L-lactate dehydrogenase [cytochrome] OS=Escherichi... [more]
LLDD_ECO452.872e-1933.54L-lactate dehydrogenase [cytochrome] OS=Escherichi... [more]
LLDD_ESCF34.899e-1933.54L-lactate dehydrogenase [cytochrome] OS=Escherichi... [more]
LLDD_CITK84.899e-1933.54L-lactate dehydrogenase [cytochrome] OS=Citrobacte... [more]
LLDD_XANC56.398e-1934.16L-lactate dehydrogenase [cytochrome] OS=Xanthomona... [more]
LLDD_HAEIN6.398e-1934.57L-lactate dehydrogenase [cytochrome] OS=Haemophilu... [more]
LLDD_HAEIG6.398e-1934.57L-lactate dehydrogenase [cytochrome] OS=Haemophilu... [more]
LLDD_HAEIE6.398e-1934.57L-lactate dehydrogenase [cytochrome] OS=Haemophilu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H05EF RVDevelop1 Citrus clementina cDNA clone C32014H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920925 ID=FC920925|Name=FC920925|organism=Citrus clementina|type=EST|length=698bp
ACTAATCCTTTATACGCTTCTTGACTTTAACTCTGCCCCCGACTCACTGT
TGTAATCTGCTTCACGATCGACCTTCATCAGTTGAAATTTTTAGTCATTC
GGGTTCATTTCTTTACAAAATTCTATTGTTTAAGTTTGATTAATAGTTAT
TCGAATCGGTTTCACATGGCAGCTGAACCTGTTAATTTGAATGAGTTCCA
AGAATTGGCAAGGCTGGCCCTTCCAAAAATGTATTATGATTTCTACGCTG
GTGGAGCAGAAGATGAACATACCCTAAAAGAGAATGTGGAAGCCTTTCAT
AGAATTACGTTTCGGCCAAGAATTCTTGTCGATGTCAGCAGAATAGATTT
ATCGACTACTATACTTGATTACAAAATCTCGGCTCCCATTATCATTGCTC
CAACGGCTTTCCATAAGCTTGCAAACCCTGAAGGAGAAGTAGCCACAGCC
AGAGCAGCAGCTTCATGTAACACCATAATGGTTTTATCCTTCACATCTAG
CAGCACCATAGAGGAGGTTGCGGCCAGCTCCAATGCTGTTCGCTTCTATC
AATTATATGTATTCAAGAAACGAGATATAACAGCTACTCTAGTGCAGAGA
GCTGAAAGGAATGGTTTTAAGGCTCTTGTCCTAACTGCTGATACTCCAAG
ACTTGGTAGAAGGGAGGCAGATATAAAGAACAAATGATTACACGCCGT
back to top