FC920928

Overview
NameFC920928
Unique NameFC920928
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length661
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig90 contig Ccv1_Contig90:166..826. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAHC_HORVU (Carbonic anhydrase, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.884e-38
Identity = 79/148 (53.38%), Postives = 95/148 (64.19%), Query Frame = 3
Query:  207 SVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVKIGIPAKSKVFTEHGDKPFGD 650
            +VER+K GF  FK E Y+K P  +  L  GQ+PKYMVFAC+DSRVCPS  L  +PGEAF +RN+AN+VP Y + K              LKV  IVVIGHS CGGIK L+S     ++S  F+EDWV+IG PAK KV TE    PF D
Sbjct:  126 AVERLKTGFEKFKTEVYDKKPDFFEPLKAGQAPKYMVFACADSRVCPSVTLGLEPGEAFTIRNIANMVPAYCKNKYAGVGSAIEYAVCALKVEVIVVIGHSRCGGIKALLSLKDGADDSFHFVEDWVRIGFPAKKKVQTECASMPFDD 273          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_ECOLI (Carbonic anhydrase 1 OS=Escherichia coli (strain K12) GN=cynT PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.516e-16
Identity = 43/110 (39.09%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  210 VERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMS 539
            ++ I +GF+ F+RE + K  AL+ +LA  QSP+ +  +CSDSR+ P  V   +PG+ FV+RN  NIVP Y   +              L+VS+IV+ GHS CG +  + S
Sbjct:    1 MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSYG-PEPGGVSASVEYAVAALRVSDIVICGHSNCGAMTAIAS 109          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_ECO57 (Carbonic anhydrase 1 OS=Escherichia coli O157:H7 GN=cynT PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.516e-16
Identity = 43/110 (39.09%), Postives = 64/110 (58.18%), Query Frame = 3
Query:  210 VERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMS 539
            ++ I +GF+ F+RE + K  AL+ +LA  QSP+ +  +CSDSR+ P  V   +PG+ FV+RN  NIVP Y   +              L+VS+IV+ GHS CG +  + S
Sbjct:    1 MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLVPELVTQREPGDLFVIRNAGNIVPSYG-PEPGGVSASVEYAVAALRVSDIVICGHSNCGAMTAIAS 109          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_SYNY3 (Carbonic anhydrase OS=Synechocystis sp. (strain PCC 6803) GN=icfA PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.517e-15
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  210 VERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVK 590
            ++R+ EG   F+   +  +  L+ +L+ GQ P+ +   CSDSRV P+ +   + G+ FV+RN  NI+PPY                + L+++ I+V GHS CG +KGL+            + DW+K
Sbjct:    1 MQRLIEGLQKFREGYFSSHRDLFEQLSHGQHPRILFICCSDSRVDPNLITQSEVGDLFVIRNAGNIIPPYGAAN-GGEGAAMEYALVALEINQIIVCGHSHCGAMKGLLKLN-SLQEKLPLVYDWLK 125          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_SYNE7 (Carbonic anhydrase OS=Synechococcus elongatus (strain PCC 7942) GN=icfA PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.112e-14
Identity = 39/127 (30.71%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  210 VERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFTFDGNNSTDFIEDWVK 590
            + ++ EG  HF+   Y  +  L+ + AKGQ P+ +   CSDSR+ P+ +     GE FV+RN  N++PP+                  L + ++VV GHS CG +KGL+            + DW++
Sbjct:    1 MRKLIEGLRHFRTSYYPSHRDLFEQFAKGQHPRVLFITCSDSRIDPNLITQSGMGELFVIRNAGNLIPPFGAANGGEGASIEYAIAA-LNIEHVVVCGHSHCGAMKGLLKLN-QLQEDMPLVYDWLQ 125          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CAN_EMENI (Carbonic anhydrase OS=Emericella nidulans GN=AN1805 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 1.897e-14
Identity = 46/126 (36.51%), Postives = 67/126 (53.17%), Query Frame = 3
Query:  183 PSDTKAF-----DSVERIKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMSFT 545
            PSD KA       + ++I E    +   K   +P  +++LA GQSP+Y+   CSDSRV  + ++    GE FV RN+AN+VP  D +              HLKV +IVV GH  CGG++  ++ T
Sbjct:    4 PSDRKAVTRYLEQTHDKIFESNRAWVASKKGADPEFFNKLAAGQSPEYLYIGCSDSRVPANEIMGLDAGEVFVHRNIANVVPTIDLSSMSVINYAVG----HLKVKHIVVCGHYNCGGVQAALTPT 125          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_PSEAE (Carbonic anhydrase OS=Pseudomonas aeruginosa GN=cynT PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.478e-14
Identity = 43/107 (40.19%), Postives = 57/107 (53.27%), Query Frame = 3
Query:  219 IKEGFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXLHLKVSNIVVIGHSACGGIKGLMS 539
            I +GF+ F+R+ Y     L+  LA  Q+PK +  ACSDSRV P  +   +PGE FV+RN  NIVP Y                + L V +IVV GHS CG +  + S
Sbjct:    4 IIDGFLRFQRDAYPARSQLFKSLATRQAPKALFIACSDSRVVPELLTQREPGELFVIRNAGNIVPGYGPQPGGVSASVEYAVAV-LGVGDIVVCGHSDCGAMGAIAS 109          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_HELPJ (Carbonic anhydrase OS=Helicobacter pylori J99 GN=cynT PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.416e-14
Identity = 41/133 (30.83%), Postives = 66/133 (49.62%), Query Frame = 3
Query:  228 GFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXL-HLKVSNIVVIGHSACGGIKGLMSFTFDGNN--STDFIEDWVKIGIPAKSKV 617
            G + F+  +YE+   LY  L   Q P  +  +C DSRV P+ +   QPGE +V+RN+ N++PP    K            + H+ V N+++ GHS CG   G +    D      T +I +W++   P K ++
Sbjct:    6 GALEFQENEYEEFKELYESLKTKQKPHTLFISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPKTSYKESLSTIASVEYAIAHVGVQNLIICGHSDCGAC-GSIHLIHDETTKAKTPYIANWIQFLEPIKEEL 137          
BLAST of FC920928 vs. ExPASy Swiss-Prot
Match: CYNT_HELPY (Carbonic anhydrase OS=Helicobacter pylori GN=cynT PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 8.813e-12
Identity = 39/133 (29.32%), Postives = 64/133 (48.12%), Query Frame = 3
Query:  228 GFIHFKREKYEKNPALYSELAKGQSPKYMVFACSDSRVCPSHVLDFQPGEAFVVRNVANIVPPYDQTKXXXXXXXXXXXXL-HLKVSNIVVIGHSACGGIKGLMSFTFDGNN--STDFIEDWVKIGIPAKSKV 617
            G + F+  +YE+   LY  L   Q P  +  +C DSRV P+ +   +PGE +V+ N+ N+ PP    K            + H+ V N+++ GHS CG   G +    D      T +I +W++   P K ++
Sbjct:    6 GALEFQENEYEELKELYESLKTKQKPHTLFISCVDSRVVPNLITGTKPGELYVICNMGNVNPPKTSYKESLSTIASIEYAIAHVGVQNLIICGHSDCGAC-GSVHLIHDETTKAKTPYIANWIQFLEPVKEEL 137          
The following BLAST results are available for this feature:
BLAST of FC920928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
CAHC_HORVU1.884e-3853.38Carbonic anhydrase, chloroplastic OS=Hordeum vulga... [more]
CYNT_ECOLI4.516e-1639.09Carbonic anhydrase 1 OS=Escherichia coli (strain K... [more]
CYNT_ECO574.516e-1639.09Carbonic anhydrase 1 OS=Escherichia coli O157:H7 G... [more]
CYNT_SYNY38.517e-1531.50Carbonic anhydrase OS=Synechocystis sp. (strain PC... [more]
CYNT_SYNE71.112e-1430.71Carbonic anhydrase OS=Synechococcus elongatus (str... [more]
CAN_EMENI1.897e-1436.51Carbonic anhydrase OS=Emericella nidulans GN=AN180... [more]
CYNT_PSEAE2.478e-1440.19Carbonic anhydrase OS=Pseudomonas aeruginosa GN=cy... [more]
CYNT_HELPJ9.416e-1430.83Carbonic anhydrase OS=Helicobacter pylori J99 GN=c... [more]
CYNT_HELPY8.813e-1229.32Carbonic anhydrase OS=Helicobacter pylori GN=cynT ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H09EF RVDevelop1 Citrus clementina cDNA clone C32014H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920928 ID=FC920928|Name=FC920928|organism=Citrus clementina|type=EST|length=661bp
AGCTAAAGATCGTCAAANAAAAAGAAGAAGAAAAAAAAATTATTCTAATT
AATAGGGAAGACATGGCAAATTACTCGTACGAGGAAGCCATTGAAGCTCT
CAAGAAACTTCTCAAGGAGAAGGAAGACTTGAAACCTGTTGCTGCTGCAA
AAGTAGAGCAGATTACTGCGCAGCTACAGACTCCATCTGACACCAAAGCA
TTTGATTCCGTGGAGAGGATCAAAGAGGGCTTCATTCACTTCAAGAGAGA
AAAATACGAGAAAAATCCAGCTCTGTACTCTGAGCTAGCCAAAGGCCAAA
GCCCGAAGTATATGGTATTTGCCTGCTCAGACTCCAGGGTTTGCCCGTCC
CATGTGTTGGATTTTCAACCTGGGGAAGCTTTCGTGGTTCGCAATGTTGC
TAACATTGTTCCACCCTATGATCAGACTAAATATGCTGGAGTTGGAGCTG
CTGTCGAGTATGCAGTTTTGCATCTCAAGGTTTCAAACATTGTGGTCATT
GGGCACAGCGCCTGTGGTGGCATCAAAGGACTCATGTCTTTCACATTTGA
TGGAAACAACTCCACCGATTTCATTGAAGACTGGGTGAAAATTGGCATCC
CTGCCAAGTCTAAGGTGTTTACAGAGCATGGTGACAAGCCTTTTGGAGAC
AATGCACATAC
back to top