BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 7.281e-69
Identity = 118/147 (80.27%), Postives = 128/147 (87.07%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DLQ+DPP  CSAGPV +D+FHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVPEIAH YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC4_SCHPO (Ubiquitin-conjugating enzyme E2 4 OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 9.510e-69
Identity = 116/147 (78.91%), Postives = 135/147 (91.84%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI +EL DL KDPP+SCSAGPV +D+FHWQATIMGP DSPYAGGVF ++IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICSLLTDPNPDDPLVPEIAH+YK+D+++YE +AR WT+KYA+
Sbjct:    1 MALKRINRELADLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 9.510e-69
Identity = 117/147 (79.59%), Postives = 134/147 (91.16%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP+SCSAGPV ED+FHWQATIMGP DSPYAGGVF + IHFP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISKVLLSICS+LTDPNPDDPLVPEIAH+YK+ +A+YE+TAR WT+KYA+
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.767e-68
Identity = 116/147 (78.91%), Postives = 128/147 (87.07%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DLQ+DPP  CSAGPV +D+FHWQATIMGPPDS Y GGVF +T+HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YKSDK KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.767e-68
Identity = 116/147 (78.91%), Postives = 128/147 (87.07%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DLQ+DPP  CSAGPV +D+FHWQATIMGPPDS Y GGVF +T+HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YKSDK KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D1_BOVIN (Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus GN=UBE2D1 PE=2 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.767e-68
Identity = 116/147 (78.91%), Postives = 128/147 (87.07%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DLQ+DPP  CSAGPV +D+FHWQATIMGPPDS Y GGVF +T+HFP DYPFKPPK+AF TK++HPNINSNGSICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDPLVP+IA +YKSDK KY   AR WTQKYAM
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC4_CANAL (Ubiquitin-conjugating enzyme E2 4 OS=Candida albicans GN=UBC4 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 6.164e-68
Identity = 114/147 (77.55%), Postives = 133/147 (90.48%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            M+ KRI KEL DL +DPP+SCSAGPV +D++HWQA+IMGPPDSPYAGGVF ++IHFP DYP KPPK+A  TK++HPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTD NPDDPLVPEIAH+YK D+ KYEATA+ WT+KYA+
Sbjct:    1 MSLKRINKELSDLGRDPPSSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPLKPPKIALTTKIYHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKQDRKKYEATAKEWTKKYAV 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBCD1_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=eff PE=1 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 8.051e-68
Identity = 116/147 (78.91%), Postives = 129/147 (87.76%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL+DL +DPP  CSAGPV +D+FHWQATIMGPPDSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WT+KYAM
Sbjct:    1 MALKRINKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_CAEEL (Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditis elegans GN=let-70 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 115/147 (78.23%), Postives = 129/147 (87.76%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL+DL +DPP  CSAGPV +D+FHWQATIMGPP+SPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ +Y   AR WTQKYAM
Sbjct:    1 MALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_XENLA (Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laevis GN=ube2d2 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 117/147 (79.59%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2D4_HUMAN7.281e-6980.27Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens... [more]
UBC4_SCHPO9.510e-6978.91Ubiquitin-conjugating enzyme E2 4 OS=Schizosacchar... [more]
UBC1_MAGGR9.510e-6979.59Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
UB2D1_MOUSE2.767e-6878.91Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus... [more]
UB2D1_HUMAN2.767e-6878.91Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens... [more]
UB2D1_BOVIN2.767e-6878.91Ubiquitin-conjugating enzyme E2 D1 OS=Bos taurus G... [more]
UBC4_CANAL6.164e-6877.55Ubiquitin-conjugating enzyme E2 4 OS=Candida albic... [more]
UBCD1_DROME8.051e-6878.91Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC2_CAEEL1.373e-6778.23Ubiquitin-conjugating enzyme E2 2 OS=Caenorhabditi... [more]
UB2D2_XENLA1.373e-6779.59Ubiquitin-conjugating enzyme E2 D2 OS=Xenopus laev... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top