BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UE2NL_HUMAN (Putative ubiquitin-conjugating enzyme E2 N-like OS=Homo sapiens GN=UBE2NL PE=5 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.389e-27
Identity = 63/144 (43.75%), Postives = 88/144 (61.11%), Query Frame = 2
Query:  167 RILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPP-DSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            RI+KE + L  +P     A P   +  ++   I G   DSP+ GG F   +    +YP   PKV F TK++HPN++    I LDILK++WSPAL I  VLLSI +LL  PNPDDPL  ++   +K+++A+   TAR+WT+ YAM
Sbjct:    7 RIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAM 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBCD4_DROME (Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophila melanogaster GN=UbcD4 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.370e-27
Identity = 64/152 (42.11%), Postives = 89/152 (58.55%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPT---SCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MA  RI +E K++ +       S     V +     +  I GPPD+PY GG F++ I  P  YPF PPKV F T+++HPNI+S  G+ICLDILK+ W+ A+T+  VLLS+ +LL    PDDP    +A+ +K     +  TA+ WT  YA G
Sbjct:    4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGG 155          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2T_MOUSE (Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.042e-27
Identity = 60/148 (40.54%), Postives = 91/148 (61.49%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            + R+ KEL  L  +PP   +     + +   +A I+G  ++PY  GVF + +  P  YPF+PP+V F T ++HPNI+S+G ICLDIL    K  W P+L I+ VL SI  L+ +PNPDDPL+ +I+  +K +K  +   A+ WT+ +A
Sbjct:    4 ASRLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAKQWTEAHA 151          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2L3_MOUSE (Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus GN=Ube2l3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.042e-27
Identity = 57/146 (39.04%), Postives = 92/146 (63.01%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            AS+R++KEL++++K    +     V E ++  WQ  I+ P + PY  G F + I+FP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    +V+ S+ +L+ DP P+ PL  ++A  Y  D+ K+   A  +T+KY
Sbjct:    3 ASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2L3_HUMAN (Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens GN=UBE2L3 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.042e-27
Identity = 57/146 (39.04%), Postives = 92/146 (63.01%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            AS+R++KEL++++K    +     V E ++  WQ  I+ P + PY  G F + I+FP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    +V+ S+ +L+ DP P+ PL  ++A  Y  D+ K+   A  +T+KY
Sbjct:    3 ASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2L3_BOVIN (Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.042e-27
Identity = 57/146 (39.04%), Postives = 92/146 (63.01%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            AS+R++KEL++++K    +     V E ++  WQ  I+ P + PY  G F + I+FP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    +V+ S+ +L+ DP P+ PL  ++A  Y  D+ K+   A  +T+KY
Sbjct:    3 ASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC37_ARATH (Probable ubiquitin carrier protein E2 37 OS=Arabidopsis thaliana GN=UBC37 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.279e-27
Identity = 69/157 (43.95%), Postives = 94/157 (59.87%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCS------AGPVAEDMFHWQ---ATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            S R+ KELK L  DPP   S      A   + D   +    A I GP D+ YA G+F + I  P  YPF+PP V+F T ++HPNI+++G ICLDIL    K  W P+L IS VL S+  LL++PNPDD L+ E++  YK ++  ++  AR  T+KYA
Sbjct:    8 SLRMQKELKLLLSDPPHGASFPHLSSAANGSGDFSTFSTIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTFDYKAREMTEKYA 164          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2L3_PONAB (Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii GN=UBE2L3 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.279e-27
Identity = 57/146 (39.04%), Postives = 92/146 (63.01%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILK-EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            AS+R++KEL++++K    +     V E ++  WQ  I+ P + PY  G F + I+FP +YPFKPPK+ F+TK++HPNI+  G +CL ++  E W PA    +V+ S+ +L+ DP P+ PL  ++A  Y  D+ K+   A  +T+KY
Sbjct:    3 ASRRLMKELEEIRKCGMKNFRNIRVDEANLLTWQGLIV-PDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKY 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G2_BOVIN (Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 5.837e-26
Identity = 58/157 (36.94%), Postives = 89/157 (56.69%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            A KR++ E K L  +PP    AGP+ E+  F W+A IMGP D+ +  GVF   + FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K+LLS+ S+L +PN +     + + M++ D+ ++   A+   QK
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKVAKQIVQK 161          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G2_PONAB (Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.623e-26
Identity = 58/157 (36.94%), Postives = 89/157 (56.69%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            A KR++ E K L  +PP    AGP+ E+  F W+A IMGP D+ +  GVF   + FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K+LLS+ S+L +PN +     + + M++ D+ ++   A+   QK
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UE2NL_HUMAN1.389e-2743.75Putative ubiquitin-conjugating enzyme E2 N-like OS... [more]
UBCD4_DROME2.370e-2742.11Ubiquitin-conjugating enzyme E2-22 kDa OS=Drosophi... [more]
UBE2T_MOUSE4.042e-2740.54Ubiquitin-conjugating enzyme E2 T OS=Mus musculus ... [more]
UB2L3_MOUSE4.042e-2739.04Ubiquitin-conjugating enzyme E2 L3 OS=Mus musculus... [more]
UB2L3_HUMAN4.042e-2739.04Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens... [more]
UB2L3_BOVIN4.042e-2739.04Ubiquitin-conjugating enzyme E2 L3 OS=Bos taurus G... [more]
UBC37_ARATH5.279e-2743.95Probable ubiquitin carrier protein E2 37 OS=Arabid... [more]
UB2L3_PONAB5.279e-2739.04Ubiquitin-conjugating enzyme E2 L3 OS=Pongo abelii... [more]
UB2G2_BOVIN5.837e-2636.94Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus G... [more]
UB2G2_PONAB7.623e-2636.94Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top