BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G2_MOUSE (Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.623e-26
Identity = 58/157 (36.94%), Postives = 89/157 (56.69%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            A KR++ E K L  +PP    AGP+ E+  F W+A IMGP D+ +  GVF   + FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K+LLS+ S+L +PN +     + + M++ D+ ++   A+   QK
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G2_HUMAN (Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.623e-26
Identity = 58/157 (36.94%), Postives = 89/157 (56.69%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            A KR++ E K L  +PP    AGP+ E+  F W+A IMGP D+ +  GVF   + FP DYP  PPK+ F  ++FHPNI  +G +C+ IL              E+WSP  ++ K+LLS+ S+L +PN +     + + M++ D+ ++   A+   QK
Sbjct:    5 ALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQK 161          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2S_XENTR (Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropicalis GN=ube2s PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.956e-26
Identity = 57/145 (39.31%), Postives = 83/145 (57.24%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            +++ KE+  L  DPP      P  ED+   Q  I GP  +PYAGG+F + +    D+P  PPK  F TK+FHPN+++NG IC+++LK+ W   L I  VLL+I  LL  PNP+  L  E   +   +  +Y + AR  T+ +A G
Sbjct:   14 RQVYKEVSTLTSDPPEGIKIIPNEEDITDVQVNIEGPEGTPYAGGIFRMKLILGKDFPAAPPKGYFLTKIFHPNVSTNGEICVNVLKKDWKAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYASRARLMTEIHAQG 158          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC7_SCHPO (Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe GN=ubc3 PE=2 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 9.956e-26
Identity = 55/158 (34.81%), Postives = 88/158 (55.70%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAED-MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            MA +R++KE K+L ++ P   +AGP  ED  F W   I GP  +P+ GG++  T+ FP DYP  PP + F  + FHPN+  +G++C+ IL              E+WSP  ++ K+LLS+ S+L +PN +     +   M++ D+ +Y    R   +K
Sbjct:    5 MALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFEGGLYPATLKFPSDYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARK 162          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2SB_XENLA (Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus laevis GN=ube2s-B PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 9.956e-26
Identity = 58/145 (40.00%), Postives = 82/145 (56.55%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            +R+ KE+  L  DPP      P  ED+   Q  I GP  +PYAGG+F + +    D+P  PPK  F TK+FHPN+++NG IC+++LK+ W   L I  VLL+I  LL  PNP+  L  E   +   +  +Y + AR  T  +A G
Sbjct:   14 RRVYKEVSTLTSDPPEGIKIIPNEEDITDVQVNIEGPEGTPYAGGMFRMKLILGKDFPAAPPKGYFLTKIFHPNVSNNGEICVNVLKKDWKAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYASRARLMTDIHAQG 158          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2S_RANCA (Ubiquitin-conjugating enzyme E2 S OS=Rana catesbeiana GN=ube2s PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.218e-25
Identity = 57/143 (39.86%), Postives = 83/143 (58.04%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +++ KE+  L  DPP      P  ED+   Q +I GP  +PYAGG+F + +    D+P  PPK  F TK+FHPN++SNG IC+++LK+ W   L I  VLL+I  LL  PNP+  L  E   +   +  +Y + AR  T+ +A
Sbjct:   14 RQVYKEVSTLTPDPPEGIKIIPNEEDITDVQVSIEGPEGTPYAGGIFRMKLILGKDFPAAPPKGYFLTKIFHPNVSSNGEICVNVLKKDWKAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYASRARLMTEIHA 156          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC11_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC11 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.218e-25
Identity = 56/133 (42.11%), Postives = 83/133 (62.41%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY 556
            +KR+  EL  L      S SA PV + D+ +W   I GP D+PY+G  F V++ FP +YPF PP + F + ++HPN++ +G+ICLDILKE+WS    +  +LLS+ SLL +PN   PL    A ++ +D  +Y
Sbjct:   10 TKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEY 142          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC21_ARATH (Probable ubiquitin carrier protein E2 21 OS=Arabidopsis thaliana GN=UBC21 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.897e-25
Identity = 58/147 (39.46%), Postives = 87/147 (59.18%), Query Frame = 2
Query:  167 RILKELKDLQKDPPTSCSAGPVAED--MFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKS-DKAKYEATARSWTQKYAM 595
            R+ KE K++Q++         + +D  +F W A I GP ++PY GGVF +    P  YP +PP+V F TK+FHPN++   G ICLDILK  WSPA T+  V  +I +L+  P PD PL  +  ++ +S D   + + A+ +T+  AM
Sbjct:    7 RLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFNSMAQMYTRLAAM 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G1_RAT (Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 2.897e-25
Identity = 51/138 (36.96%), Postives = 84/138 (60.87%), Query Frame = 2
Query:  176 KELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDK 547
            ++L +L K+P    SAG + + D++ W+  I+GPPD+ Y GGVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL             +E+W P  T+  +++S+ S+L DPN D P   + A  ++ D+
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDR 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2G1_MOUSE (Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3)

HSP 1 Score: 115.161 bits (287), Expect = 2.897e-25
Identity = 51/138 (36.96%), Postives = 84/138 (60.87%), Query Frame = 2
Query:  176 KELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL-------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDK 547
            ++L +L K+P    SAG + + D++ W+  I+GPPD+ Y GGVF   + FP DYP +PPK+ F T+++HPN++ NG +C+ IL             +E+W P  T+  +++S+ S+L DPN D P   + A  ++ D+
Sbjct:   12 RQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDR 149          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2G2_MOUSE7.623e-2636.94Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus... [more]
UB2G2_HUMAN7.623e-2636.94Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens... [more]
UBE2S_XENTR9.956e-2639.31Ubiquitin-conjugating enzyme E2 S OS=Xenopus tropi... [more]
UBC7_SCHPO9.956e-2634.81Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosa... [more]
UB2SB_XENLA9.956e-2640.00Ubiquitin-conjugating enzyme E2 S-B OS=Xenopus lae... [more]
UBE2S_RANCA2.218e-2539.86Ubiquitin-conjugating enzyme E2 S OS=Rana catesbei... [more]
UBC11_YEAST2.218e-2542.11Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]
UBC21_ARATH2.897e-2539.46Probable ubiquitin carrier protein E2 21 OS=Arabid... [more]
UB2G1_RAT2.897e-2536.96Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norve... [more]
UB2G1_MOUSE2.897e-2536.96Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top