BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_RAT (Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norvegicus GN=Ube2d2 PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 117/147 (79.59%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_MOUSE (Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus GN=Ube2d2 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 117/147 (79.59%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_HUMAN (Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens GN=UBE2D2 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 117/147 (79.59%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_BOVIN (Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.373e-67
Identity = 117/147 (79.59%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   AR WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC5_YEAST (Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharomyces cerevisiae GN=UBC5 PE=1 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.342e-67
Identity = 114/146 (78.08%), Postives = 133/146 (91.10%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +SKRI KEL DL +DPP SCSAGPV +D++HWQA+IMGP DSPYAGGVF ++IHFP DYPFKPPKV F TK++HPNINS+G+ICLDILK+QWSPALT+SKVLLSICSLLTD NPDDPLVPEIA +YK+DKAKYEATA+ WT+KYA+
Sbjct:    3 SSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYAV 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_RAT (Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_PONAB (Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_MOUSE (Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus GN=Ube2d3 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_MACFA (Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fascicularis GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_HUMAN (Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens GN=UBE2D3 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2D2_RAT1.373e-6779.59Ubiquitin-conjugating enzyme E2 D2 OS=Rattus norve... [more]
UB2D2_MOUSE1.373e-6779.59Ubiquitin-conjugating enzyme E2 D2 OS=Mus musculus... [more]
UB2D2_HUMAN1.373e-6779.59Ubiquitin-conjugating enzyme E2 D2 OS=Homo sapiens... [more]
UB2D2_BOVIN1.373e-6779.59Ubiquitin-conjugating enzyme E2 D2 OS=Bos taurus G... [more]
UBC5_YEAST2.342e-6778.08Ubiquitin-conjugating enzyme E2-16 kDa OS=Saccharo... [more]
UB2D3_RAT3.995e-6778.91Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norve... [more]
UB2D3_PONAB3.995e-6778.91Ubiquitin-conjugating enzyme E2 D3 OS=Pongo abelii... [more]
UB2D3_MOUSE3.995e-6778.91Ubiquitin-conjugating enzyme E2 D3 OS=Mus musculus... [more]
UB2D3_MACFA3.995e-6778.91Ubiquitin-conjugating enzyme E2 D3 OS=Macaca fasci... [more]
UB2D3_HUMAN3.995e-6778.91Ubiquitin-conjugating enzyme E2 D3 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top