BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC6_DEBHA (Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces hansenii GN=UBC6 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.666e-13
Identity = 38/116 (32.76%), Postives = 61/116 (52.59%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLT 487
            S  + KR+ KE K +  +PP   SA P  E++  W   I GPP +P+  G +   + FP +YPFKPP ++  T   +     N  +CL   D   + W+PA +++ +L  + S +T
Sbjct:    3 SRQSQKRLTKEYKAITLNPPPYVSAKPNDENILEWHYVITGPPHTPFEEGQYHGILRFPSEYPFKPPSISMITP--NGRFACNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFMT 116          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: Y1A1_ENCCU (Probable ubiquitin-conjugating enzyme E2 ECU01_1010 OS=Encephalitozoon cuniculi GN=ECU01_1010 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.401e-13
Identity = 35/107 (32.71%), Postives = 56/107 (52.34%), Query Frame = 2
Query:  278 DSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL--------------KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY 556
            DS YAG +    + FP  YP +PP + F +K+FHPNI  +G +C+ IL              K++W+P   I  +++SI  +L  PN   P   + + MY+ +  +Y
Sbjct:   77 DSLYAGRILKAVMKFPSSYPLRPPTLKFVSKMFHPNIYEDGKMCISILEEDKQQDSSVFGDPKDKWTPVQNIRTIVMSIVVILNSPNISSPANVDASVMYRDNPEEY 183          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC17_CAEEL (Probable ubiquitin-conjugating enzyme protein 17 OS=Caenorhabditis elegans GN=ubc-17 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 3.673e-12
Identity = 46/122 (37.70%), Postives = 64/122 (52.46%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVA------EDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTK-----VFHPNINSNGSICLDIL-------KEQWSPALTISKVLLSI 472
            +KRI KEL  +    P + S            D+   +  I GP D+PYA G+F   I FP  YPF PPK AF T       F+PN+ ++G ICL IL       +E+W+P  ++ +VL+SI
Sbjct:  411 TKRIAKELASIANALPLNASNSIYVCYDEGRVDII--KVLISGPDDTPYANGLFEFDIFFPTGYPFSPPKCAFLTTGSGNVRFNPNLYNDGKICLSILGTWEGRPEEKWNPYCSLMQVLVSI 530          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC12_CAEEL (NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis elegans GN=ubc-12 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.797e-12
Identity = 44/136 (32.35%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  203 PPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ------WSPALTISKVLLSICSLLTD-PNPDDPLVPEIAHMYKSDKAKYEATARSWTQKY 589
            P TSC          H     + P +  Y GG F   I  PP+Y   PP V   TKV+HPNIN +GSICL IL++       W P   ++ V+  + SL  D  + +D L  + A M+  ++  +    R +  +Y
Sbjct:   53 PSTSC---------LHELELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNINEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNRESFNHRVREYISRY 179          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2J2_MOUSE (Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus GN=Ube2j2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11
Identity = 38/142 (26.76%), Postives = 69/142 (48.59%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARS 574
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +PY GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +        P +  +  SD  K +  A+S
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKG------PTLGSIETSDFTKKQLAAQS 146          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2J2_BOVIN (Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus GN=UBE2J2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.109e-11
Identity = 38/142 (26.76%), Postives = 69/142 (48.59%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARS 574
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +PY GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +        P +  +  SD  K +  A+S
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKG------PTLGSIETSDFTKRQLAAQS 146          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2J2_HUMAN (Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens GN=UBE2J2 PE=1 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 4.061e-11
Identity = 33/117 (28.21%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICL---DILKEQWSPALTISKVLLSICSLLTDPNP 499
            A++R+ ++   ++KDP     A P+  ++  W   + GP  +PY GG +   + FP ++PFKPP +   T   +     N  +CL   D   + W+PA ++S +L  + S + +  P
Sbjct:   13 ATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC6_DEBHA5.666e-1332.76Ubiquitin-conjugating enzyme E2 6 OS=Debaryomyces ... [more]
Y1A1_ENCCU7.401e-1332.71Probable ubiquitin-conjugating enzyme E2 ECU01_101... [more]
UBC17_CAEEL3.673e-1237.70Probable ubiquitin-conjugating enzyme protein 17 O... [more]
UBC12_CAEEL4.797e-1232.35NEDD8-conjugating enzyme ubc-12 OS=Caenorhabditis ... [more]
UB2J2_MOUSE3.109e-1126.76Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus... [more]
UB2J2_BOVIN3.109e-1126.76Ubiquitin-conjugating enzyme E2 J2 OS=Bos taurus G... [more]
UB2J2_HUMAN4.061e-1128.21Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top