BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D2_PIG (Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa GN=UBE2D2 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 3.995e-67
Identity = 116/147 (78.91%), Postives = 127/147 (86.39%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSNGSICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC12_ARATH (Probable ubiquitin-conjugating enzyme E2 12 OS=Arabidopsis thaliana GN=UBC12 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.518e-66
Identity = 118/149 (79.19%), Postives = 134/149 (89.93%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            MASKRI +EL+D+Q+ PP +CSAGPVAE D+FHWQATIMGP DSPY+GGVF V+I F  DYPFKPPKV F+TKV+HPNI+S GSICLDILKEQWSPA T SKVLLSICSLLTDPNP+DPLVPEIAH+YK DK+KYE+TA+ WTQKYAMG
Sbjct:    1 MASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKVDKSKYESTAQKWTQKYAMG 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2D3_BOVIN (Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus GN=UBE2D3 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 2.590e-66
Identity = 115/147 (78.23%), Postives = 126/147 (85.71%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV +DMFHWQATIMGP DSPY GGVF +TIHFP DYPFKPPKVAF T+++HPNINSN SICLDIL+ QWSPALTISKVLLSICSLL DPNPDDPLVPEIA +YK+D+ KY   +R WTQKYAM
Sbjct:    1 MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNDSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: U2D2B_RAT (Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norvegicus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.421e-64
Identity = 113/147 (76.87%), Postives = 124/147 (84.35%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV EDMFHWQATIMGP DSPY GG F +TI FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISKVLLSI SLL DPNPDDPLVPEIA +YK+D+ KY  TAR WTQKYAM
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: U2D2B_MOUSE (Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculus GN=Ube2d2b PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.421e-64
Identity = 113/147 (76.87%), Postives = 124/147 (84.35%), Query Frame = 2
Query:  155 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            MA KRI KEL DL +DPP  CSAGPV EDMFHWQATIMGP DSPY GG F +TI FP +YPFKPPKV F T+++HPN+NSNGSICLDIL+ QWSPALTISKVLLSI SLL DPNPDDPLVPEIA +YK+D+ KY  TAR WTQKYAM
Sbjct:    1 MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E2_MOUSE (Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus GN=Ube2e2 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.992e-50
Identity = 90/145 (62.07%), Postives = 115/145 (79.31%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E2_HUMAN (Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens GN=UBE2E2 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.992e-50
Identity = 90/145 (62.07%), Postives = 115/145 (79.31%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F PDYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   56 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E1_MOUSE (Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus GN=Ube2e1 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.992e-50
Identity = 90/145 (62.07%), Postives = 115/145 (79.31%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL D+  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   48 SAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E1_HUMAN (Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens GN=UBE2E1 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.992e-50
Identity = 90/145 (62.07%), Postives = 115/145 (79.31%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL D+  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   48 SAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 192          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBCD2_DROME (Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophila melanogaster GN=UbcD2 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 7.570e-50
Identity = 89/145 (61.38%), Postives = 113/145 (77.93%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W +TI+GPP S Y GGVF + IHF P+YPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y  ++ +++  AR WT++YA
Sbjct:   87 SAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2D2_PIG3.995e-6778.91Ubiquitin-conjugating enzyme E2 D2 OS=Sus scrofa G... [more]
UBC12_ARATH1.518e-6679.19Probable ubiquitin-conjugating enzyme E2 12 OS=Ara... [more]
UB2D3_BOVIN2.590e-6678.23Ubiquitin-conjugating enzyme E2 D3 OS=Bos taurus G... [more]
U2D2B_RAT1.421e-6476.87Ubiquitin-conjugating enzyme E2 D2B OS=Rattus norv... [more]
U2D2B_MOUSE1.421e-6476.87Ubiquitin-conjugating enzyme E2 D2B OS=Mus musculu... [more]
UB2E2_MOUSE1.992e-5062.07Ubiquitin-conjugating enzyme E2 E2 OS=Mus musculus... [more]
UB2E2_HUMAN1.992e-5062.07Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens... [more]
UB2E1_MOUSE1.992e-5062.07Ubiquitin-conjugating enzyme E2 E1 OS=Mus musculus... [more]
UB2E1_HUMAN1.992e-5062.07Ubiquitin-conjugating enzyme E2 E1 OS=Homo sapiens... [more]
UBCD2_DROME7.570e-5061.38Ubiquitin-conjugating enzyme E2-24 kDa OS=Drosophi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top