BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E3_MOUSE (Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus GN=Ube2e3 PE=1 SV=2)

HSP 1 Score: 195.282 bits (495), Expect = 2.203e-49
Identity = 89/145 (61.38%), Postives = 114/145 (78.62%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E3_HUMAN (Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens GN=UBE2E3 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.203e-49
Identity = 89/145 (61.38%), Postives = 114/145 (78.62%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UB2E3_BOVIN (Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus GN=UBE2E3 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.203e-49
Identity = 89/145 (61.38%), Postives = 114/145 (78.62%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            ++KRI KEL ++  DPP +CSAGP  ++++ W++TI+GPP S Y GGVF + I F  DYPFKPPKV FRT+++H NINS G ICLDILK+ WSPALTISKVLLSICSLLTD NP DPLV  IA  Y +++A+++  AR WT++YA
Sbjct:   62 SAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: COP10_ARATH (Constitutive photomorphogenesis protein 10 OS=Arabidopsis thaliana GN=COP10 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.188e-40
Identity = 71/149 (47.65%), Postives = 108/149 (72.48%), Query Frame = 2
Query:  149 SIMAS-KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            S+ AS KRI +E+ +L  DPP  CSAGP  ++++HW ATI+GP  +PY GG+F + I FP DYPFKPPK+ F+T+++H N+++ G + ++IL++ WSPALTI+KVL +I S+   P P  P +P IA +Y +D+ K++  A+ WT ++A
Sbjct:   33 SVSASGKRIQREMAELNIDPPPDCSAGPKGDNLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSPALPVIARLYLTDREKHDEVAKEWTLRFA 181          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBCB_DICDI (Ubiquitin conjugating enzyme E2 B OS=Dictyostelium discoideum GN=ubcB PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.349e-37
Identity = 73/146 (50.00%), Postives = 100/146 (68.49%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            A KR+ KE+ D+ K PP+ CSA  V +++  W+AT+ GP  SP+  GVF + I  P DYPFKPP + F TK++HPNI  S+G+IC ++    WSP L I  VL +I S+LTDPNPD+PL  EIA  +K+D+  +  TA+ WT+KYA
Sbjct:    3 AHKRLQKEITDMLKTPPSWCSAHLVDDNLQKWKATVQGPEGSPFEKGVFSMDIDIPADYPFKPPTLKFTTKIYHPNIKTSDGAICAEVFST-WSPQLKILDVLTTIRSILTDPNPDNPLETEIAQQFKTDRNAFNKTAKEWTKKYA 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC36_ARATH (Ubiquitin carrier protein E2 36 OS=Arabidopsis thaliana GN=UBC36 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.254e-36
Identity = 74/145 (51.03%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            +RI+KE + L  +P    SA P  E+M ++   I+GP  SPY GGVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL   IA  +KS++A+   TA+ WT+ YA G
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASG 152          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC31_ARATH (Probable ubiquitin carrier protein E2 31 OS=Arabidopsis thaliana GN=UBC31 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.637e-36
Identity = 65/125 (52.00%), Postives = 93/125 (74.40%), Query Frame = 2
Query:  218 SAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            S G  + +++ W A I GP  +PY GG+F ++I FP DYPFKPPK  F+T ++HPNIN  GSIC++ILK++W+PAL + KVLLSI  LL  PNPDDPLVPEI  ++K+++ +++  AR +T ++A
Sbjct:   28 SIGQNSNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNILKDKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAREFTARHA 152          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC35_ARATH (Ubiquitin carrier protein E2 35 OS=Arabidopsis thaliana GN=UBC35 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.647e-36
Identity = 73/145 (50.34%), Postives = 98/145 (67.59%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAMG 598
            +RI+KE + L  +P    SA P  ++M ++   I+GP  SPY GGVF + +  P +YP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL   IA  +KS++A+   TA+ WT+ YA G
Sbjct:    8 RRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVDTAKEWTRLYASG 152          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.386e-35
Identity = 68/133 (51.13%), Postives = 89/133 (66.92%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY 556
            A KR++ + K LQKDPP   S  P   ++ HW A I GP D+P+ GG F +T+HF  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ VL SI SLL DPNPD P   E A ++  +K +Y
Sbjct:    5 AKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPDSPANAEAARLFSENKREY 137          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_DROME (Ubiquitin-conjugating enzyme E2 N OS=Drosophila melanogaster GN=ben PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.267e-35
Identity = 68/144 (47.22%), Postives = 98/144 (68.06%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L ++P    +A P   +  ++   + GP DSP+ GGVF + +  P DYP   PKV F TK++HPNI+  G ICLD+LK++WSPAL I  +LLSI +LL+ PNPDDPL  ++A ++K ++A+    AR WTQKYA+
Sbjct:    6 RRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAELWKVNEAEAIRNAREWTQKYAV 149          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UB2E3_MOUSE2.203e-4961.38Ubiquitin-conjugating enzyme E2 E3 OS=Mus musculus... [more]
UB2E3_HUMAN2.203e-4961.38Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens... [more]
UB2E3_BOVIN2.203e-4961.38Ubiquitin-conjugating enzyme E2 E3 OS=Bos taurus G... [more]
COP10_ARATH3.188e-4047.65Constitutive photomorphogenesis protein 10 OS=Arab... [more]
UBCB_DICDI7.349e-3750.00Ubiquitin conjugating enzyme E2 B OS=Dictyostelium... [more]
UBC36_ARATH1.254e-3651.03Ubiquitin carrier protein E2 36 OS=Arabidopsis tha... [more]
UBC31_ARATH1.637e-3652.00Probable ubiquitin carrier protein E2 31 OS=Arabid... [more]
UBC35_ARATH3.647e-3650.34Ubiquitin carrier protein E2 35 OS=Arabidopsis tha... [more]
UBC3_ARATH1.386e-3551.13Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBE2N_DROME5.267e-3547.22Ubiquitin-conjugating enzyme E2 N OS=Drosophila me... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top