BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_MACFA (Ubiquitin-conjugating enzyme E2 N OS=Macaca fascicularis GN=UBE2N PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.879e-35
Identity = 68/144 (47.22%), Postives = 97/144 (67.36%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++ +G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_RAT (Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 8.984e-35
Identity = 69/144 (47.92%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +KS++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_DICDI (Probable ubiquitin-conjugating enzyme E2 N OS=Dictyostelium discoideum GN=ube2n PE=3 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 8.984e-35
Identity = 70/143 (48.95%), Postives = 96/143 (67.13%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            KRI+KE + L  +P    SA P  ++  +++  I GP DSP+ GGVF + +    DYP   PKV F TK++HPNI+  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++ +  A AR WT+ YA
Sbjct:    6 KRIIKETQRLMTEPAPGISATPATDNFRYFKVAISGPLDSPFEGGVFNLELFLTDDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEHWKTNEKEAMARAREWTRLYA 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.173e-34
Identity = 70/149 (46.98%), Postives = 94/149 (63.09%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWT 580
            S  A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+ GG F +T+ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A MY  +K +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPHDNNITLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWT 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_PONAB (Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.001e-34
Identity = 68/144 (47.22%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_MOUSE (Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.001e-34
Identity = 68/144 (47.22%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_HUMAN (Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.001e-34
Identity = 68/144 (47.22%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2N_BOVIN (Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.001e-34
Identity = 68/144 (47.22%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            +RI+KE + L  +P     A P   +  ++   I GP DSP+ GG F + +  P +YP   PKV F TK++HPN++  G ICLDILK++WSPAL I  VLLSI +LL+ PNPDDPL  ++A  +K+++A+   TAR+WT+ YAM
Sbjct:    6 RRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAM 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_YEAST (Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharomyces cerevisiae GN=UBC1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.414e-34
Identity = 69/146 (47.26%), Postives = 97/146 (66.44%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAE-DMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +KRI+KE++ ++ DP    +   V+E D+ H + T +GPP +PY GG F+V I  P +YPFKPPK+ F TKV+HPNI+S  G+ICLDILK  WSP +T+   L+S+ +LL  P P+DP   E+A  Y  D+  +  TA  WT+ YA
Sbjct:    4 AKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYA 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.414e-34
Identity = 69/149 (46.31%), Postives = 92/149 (61.74%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATAR-----SWT 580
            S  A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+ GG F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A MY   K +Y    R     SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWT 150          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBE2N_MACFA6.879e-3547.22Ubiquitin-conjugating enzyme E2 N OS=Macaca fascic... [more]
UBE2N_RAT8.984e-3547.92Ubiquitin-conjugating enzyme E2 N OS=Rattus norveg... [more]
UBE2N_DICDI8.984e-3548.95Probable ubiquitin-conjugating enzyme E2 N OS=Dict... [more]
UBC2_WHEAT1.173e-3446.98Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBE2N_PONAB2.001e-3447.22Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii ... [more]
UBE2N_MOUSE2.001e-3447.22Ubiquitin-conjugating enzyme E2 N OS=Mus musculus ... [more]
UBE2N_HUMAN2.001e-3447.22Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens ... [more]
UBE2N_BOVIN2.001e-3447.22Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN... [more]
UBC1_YEAST3.414e-3447.26Ubiquitin-conjugating enzyme E2-24 kDa OS=Saccharo... [more]
UBC1_ARATH3.414e-3446.31Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top