BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC13_SCHPO (Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccharomyces pombe GN=ubc13 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.459e-34
Identity = 66/144 (45.83%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            KRI+KE++ L +DPP    A P  +++ +++ T+ GP  S Y GG F + +  P +YP  PP V F TK++HPN++  G ICL  LK+ WSPAL I  VLLSI +L+  PNPDDPL  ++A ++K ++ +  A AR WT+KYA+
Sbjct:    5 KRIIKEIETLTRDPPPGIVAAPTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDEYPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDPLDNDVAKIWKENEPQAIANAREWTKKYAV 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 5.823e-34
Identity = 68/149 (45.64%), Postives = 93/149 (62.42%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWT 580
            S  A KR++++ K LQ+DPP   S  P   ++  W A I GP D+P+ GG F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A M+   K +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSESKREYNRRVREVVEQSWT 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.605e-34
Identity = 64/146 (43.84%), Postives = 94/146 (64.38%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            S  A +R++++ K LQ+DPPT  S  P   ++  W A I GP D+P+  G F +TI F  +YP KPP V F +KVFHPN+ ++G ICLDIL+ +WSP   +S +L SI SLL+DPNP+ P     A +YK ++ +YE   ++  ++
Sbjct:    2 STPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQ 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 7.605e-34
Identity = 68/149 (45.64%), Postives = 93/149 (62.42%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWT 580
            S  A KR++++ K LQ DPP   S  P   ++  W A I GP D+P+ GG F +++ F  DYP KPP V F +++FHPNI ++GSICLDIL+ QWSP   ++ +L SI SLL DPNP+ P   E A M+  +K +Y     E   +SWT
Sbjct:    2 STPARKRLMRDFKRLQHDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREVVEQSWT 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC14_SCHPO (Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccharomyces pombe GN=ubc14 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 7.605e-34
Identity = 63/146 (43.15%), Postives = 97/146 (66.44%), Query Frame = 2
Query:  158 ASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQ-WSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            +S+R+ KE  DL++ P        V +++FHW  T +GP DS YAGG F  ++ FP DYPF+PP + F T+++HPN +S G++CL ILK+Q + P++ +  VL  I  LL +PNPDDPLV  IA  Y++D+  ++  AR + +++A
Sbjct:    8 SSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRPSFDKIARDYVEQFA 153          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC13_YEAST (Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae GN=UBC13 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.694e-33
Identity = 68/143 (47.55%), Postives = 94/143 (65.73%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            KRI+KE + L  DP    +A P  +++ ++Q TI GP  SPY  G+F + ++ P DYP + PKV F TK++HPNI+  G ICLD+LK  WSPAL I  VLLSI +LL  PNP+DPL  ++A  +  ++   +A AR WT+ YA
Sbjct:    6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_SCHPO (Ubiquitin-conjugating enzyme E2 1 OS=Schizosaccharomyces pombe GN=ubc1 PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.213e-33
Identity = 65/145 (44.83%), Postives = 92/145 (63.45%), Query Frame = 2
Query:  161 SKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYA 592
            S+RI KEL D+Q+D         + +D+ H +    GP  +PY GG F+V I  P DYPF+PPK+ F TK++HPN++S  G+ICLDILK+QWSP  T+   L+S+ SLL  P P +P   ++A +Y  +  ++  TAR WT  YA
Sbjct:    6 SRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIPIDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTPEPSNPQDAQVAQVYLQNYQQFVRTAREWTSSYA 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_ASPFU (Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus fumigatus GN=ubc2 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.173e-32
Identity = 61/148 (41.22%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +Q DPP   SA PVA+++  W A I+GP D+P+  G F + +HF   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E +++YK ++ +Y     E   +SW
Sbjct:    2 STSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPANVEASNLYKDNRKEYIKRVRETVEKSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.450e-32
Identity = 61/137 (44.53%), Postives = 89/137 (64.96%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F +TI F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 5.450e-32
Identity = 61/137 (44.53%), Postives = 89/137 (64.96%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F +TI F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC13_SCHPO4.459e-3445.83Ubiquitin-conjugating enzyme E2 13 OS=Schizosaccha... [more]
UBC2_ARATH5.823e-3445.64Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBCD6_DROME7.605e-3443.84Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBC2_MEDSA7.605e-3445.64Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC14_SCHPO7.605e-3443.15Ubiquitin-conjugating enzyme E2 14 OS=Schizosaccha... [more]
UBC13_YEAST1.694e-3347.55Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyce... [more]
UBC1_SCHPO2.213e-3344.83Ubiquitin-conjugating enzyme E2 1 OS=Schizosacchar... [more]
UBC2_ASPFU4.173e-3241.22Ubiquitin-conjugating enzyme E2 2 OS=Aspergillus f... [more]
UBE2A_MOUSE5.450e-3244.53Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN5.450e-3244.53Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top