BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_TRIHA (Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma harzianum GN=UBC2 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.450e-32
Identity = 61/148 (41.22%), Postives = 93/148 (62.84%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +Q DPP   SA P+ +++  W A I+GP D+P+  G F + + F   YP KPP+V F +++FHPN+ +NG +CLDIL+ +WSP   ++ VL SI SLL DPN   P   E +++YK ++ +Y     E   RSW
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPIPDNVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISQMFHPNVYANGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRREYIKRVRETVERSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2B_RABIT (Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2B_MOUSE (Ubiquitin-conjugating enzyme E2 B OS=Mus musculus GN=Ube2b PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2B_HUMAN (Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens GN=UBE2B PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2B_BOVIN (Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            S  A +R++++ K LQ+DPP   S  P   ++  W A I GP  +P+  G F + I F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   +S +L SI SLL +PNP+ P   + A +Y+ +K +YE
Sbjct:    2 STPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_EMENI (Ubiquitin-conjugating enzyme E2 2 OS=Emericella nidulans GN=uvsJ PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 60/150 (40.00%), Postives = 93/150 (62.00%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWTQ 583
            S  A +R++++ K +Q DPP   SA PVA+++  W A I+GP D+P+  G F + +HF   YP KPP V F +++FHPN+   G +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E +++Y+ ++ +Y     E   +SW +
Sbjct:    2 STSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPANVEASNLYRDNRKEYIKRVRETVEKSWEE 151          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_YARLI (Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipolytica GN=UBC2 PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 9.297e-32
Identity = 61/149 (40.94%), Postives = 93/149 (62.42%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATAR-----SWT 580
            S  A +R++++ K +Q+DPP   SA PVA+++  W A I+GP ++P+  G F + + F   YP KPP V F +++FHPN+ S+G +CLDIL+ +WSP   ++ +L S+ SLL DPN   P   E + +YK  + +YE   R     SWT
Sbjct:    2 STTARRRLMRDFKRMQQDPPQGVSASPVADNVLTWNAVIIGPAETPFEDGTFRMVLQFDEQYPNKPPAVKFVSQMFHPNVYSSGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNTSSPANVEASMLYKDHRQQYEKRVRDTVEASWT 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_NECHA (Ubiquitin-conjugating enzyme E2 2 OS=Nectria haematococca GN=UBC2 PE=3 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.705e-31
Identity = 59/146 (40.41%), Postives = 91/146 (62.33%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            S  A +R++++ K +Q DPP   SA PV +++  W A I+GP D+P+  G F + + F   YP KPP+V F +++FHPN+ + G +CLDIL+ +WSP   ++ VL SI SLL DPN   P   E +++YK ++ +Y    R   +K
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMQFEEQYPNKPPQVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPANVEASNLYKDNRKEYTKRVRETVEK 147          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_NEUCR (Ubiquitin-conjugating enzyme E2 2 OS=Neurospora crassa GN=mus-8 PE=3 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 3.533e-31
Identity = 59/146 (40.41%), Postives = 90/146 (61.64%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQK 586
            S  A +R++++ K +Q DPP   SA PV +++  W A I+GP D+P+  G F + +HF   YP KPP V F +++FHPN+ + G +CLDIL+ +WSP   ++ VL SI SLL DPN       E +++YK ++ +Y    R   +K
Sbjct:    2 STAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMHFEEQYPNKPPSVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSRANVEASNLYKDNRKEYHKRVRETVEK 147          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC2_TRIHA5.450e-3241.22Ubiquitin-conjugating enzyme E2 2 OS=Trichoderma h... [more]
UBE2B_RAT7.118e-3243.80Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]
UBE2B_RABIT7.118e-3243.80Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus c... [more]
UBE2B_MOUSE7.118e-3243.80Ubiquitin-conjugating enzyme E2 B OS=Mus musculus ... [more]
UBE2B_HUMAN7.118e-3243.80Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens ... [more]
UBE2B_BOVIN7.118e-3243.80Ubiquitin-conjugating enzyme E2 B OS=Bos taurus GN... [more]
UBC2_EMENI7.118e-3240.00Ubiquitin-conjugating enzyme E2 2 OS=Emericella ni... [more]
UBC2_YARLI9.297e-3240.94Ubiquitin-conjugating enzyme E2 2 OS=Yarrowia lipo... [more]
UBC2_NECHA2.705e-3140.41Ubiquitin-conjugating enzyme E2 2 OS=Nectria haema... [more]
UBC2_NEUCR3.533e-3140.41Ubiquitin-conjugating enzyme E2 2 OS=Neurospora cr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top