BQ622934

Overview
NameBQ622934
Unique NameBQ622934
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2066 contig Csv1_Contig2066:56..687. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_DICDI (Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium discoideum GN=ubc2 PE=3 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 4.614e-31
Identity = 63/149 (42.28%), Postives = 92/149 (61.74%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWT 580
            S  A +R++++ K LQ DPP   S  P+  ++  WQA I GP DS + G  F +++ F  +YP   P V F +K+FHPN+ ++GSICLDIL+ QWSP   I+ +L SI SLL DPNP+ P   E A +++ +K +Y     E   +SW+
Sbjct:    2 STAARRRLMRDFKRLQSDPPAGISGAPLENNILMWQAVIFGPDDSIWEGATFKLSLQFSEEYPNDAPTVKFLSKMFHPNVYADGSICLDILQNQWSPIYDIAAILTSIQSLLCDPNPNSPANSESARLFRENKREYNRKVKEIVEQSWS 150          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_CANGA (Ubiquitin-conjugating enzyme E2 2 OS=Candida glabrata GN=UBC2 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.026e-31
Identity = 60/148 (40.54%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +++D P   SA P+ +++  W A I+GP D+PY  G F + + F  DYP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  K++Y     E   +SW
Sbjct:    2 STPARRRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_CANAL (Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans GN=UBC2 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.026e-31
Identity = 59/148 (39.86%), Postives = 93/148 (62.84%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +Q+DPP+  SA P+ +++  W A I+GP D+P+  G F + + F   YP KPP+V F +++FHPN+ ++G +CLDIL+ +WSP   +S +L S+ SLL DPN   P   E A++YK  ++ Y     E    SW
Sbjct:    2 STPARRRLMRDFKRMQQDPPSGVSASPLPDNVMKWNAVIIGPSDTPFEDGTFRLLLSFDEQYPNKPPQVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSVQSLLNDPNISSPANVEAANLYKDHRSLYVKRVRETVENSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_DEBHA (Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces hansenii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.870e-31
Identity = 59/150 (39.33%), Postives = 93/150 (62.00%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSWTQ 583
            S  A +R++++ K +Q+D P+  SA P+ +++  W A I+GP D+P+  G F + + F   YP KPP V F +++FHPN+ ++G +CLDIL+ +WSP   +S +L SI SLL DPN   P   E A++YK  +++Y     E    SW +
Sbjct:    2 STPAKRRLMRDFKRMQQDAPSGVSASPLPDNVMSWNAVIIGPADTPFEDGTFRLILQFDEQYPNKPPSVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIKRVRETVENSWNE 151          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_USTMA (Ubiquitin-conjugating enzyme E2 2 OS=Ustilago maydis GN=UBC2 PE=3 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 58/136 (42.65%), Postives = 85/136 (62.50%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY 556
            S  + KR++++ K L  DPP   S  P A+++  W A I GP D+P+  G F + + F   YP KPP V F +K+FHPN+ +NG +CLDIL+ +WSP   ++ +L SI SLL DPNP+ P   E A +Y+ +  +Y
Sbjct:    2 STPSKKRLIRDFKRLSTDPPGGISGAPCADNLMIWNAVIFGPADTPFEDGTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPNSPANAEAASLYRENMKEY 137          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC1_CAEEL (Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.342e-30
Identity = 55/132 (41.67%), Postives = 89/132 (67.42%), Query Frame = 2
Query:  164 KRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYE 559
            +R++++ K LQ+DPP   S  P  +++  W+A I GP ++P+  G F +++ F  +YP KPP V F +K+FHPN+ ++GSICLDIL+ +WSP   ++ +L SI SLL +PNP+ P     A +Y+ ++ +YE
Sbjct:    7 RRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYE 138          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_YEAST (Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae GN=RAD6 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.753e-30
Identity = 59/148 (39.86%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +++D P   SA P+ +++  W A I+GP D+PY  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  K++Y     E   +SW
Sbjct:    2 STPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_SCHPO (Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe GN=rhp6 PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 1.753e-30
Identity = 58/141 (41.13%), Postives = 89/141 (63.12%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATAR 571
            S  A +R++++ K +Q+DPP   SA PV++++  W A I+GP D+P+  G F + + F   YP KPP V F + +FHPN+ +NG +CLDIL+ +WSP   ++ +L SI SLL DPN   P   E A +++ +K +Y    R
Sbjct:    2 STTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFDEQYPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPANAEAAQLHRENKKEYVRRVR 142          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBC2_ASHGO (Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii GN=UBC2 PE=3 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.753e-30
Identity = 59/148 (39.86%), Postives = 92/148 (62.16%), Query Frame = 2
Query:  149 SIMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKY-----EATARSW 577
            S  A +R++++ K +++D P   SA P+ +++  W A I+GP D+PY  G F + + F  +YP KPP V F +++FHPN+ +NG ICLDIL+ +W+P   ++ +L SI SL  DPNP  P   E A ++K  K++Y     E   +SW
Sbjct:    2 STPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSW 149          
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Match: UBE2T_XENLA (Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevis GN=ube2t PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.290e-30
Identity = 66/147 (44.90%), Postives = 95/147 (64.63%), Query Frame = 2
Query:  167 RILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL----KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKSDKAKYEATARSWTQKYAM 595
            R+ +EL+ L K+PP          +M   +A I+G   SPY GG+F + I  P  YPF+PPK+ F T ++HPNI+S G ICLDIL    K  W PAL IS VL SI  L+++PNPDDPL+ +I+  +K ++A + + A+ WT+K+A+
Sbjct:    6 RLKRELQLLNKEPPPGVICWQNESNMDDLRAQIIGGSGSPYEGGIFNLEIIVPERYPFEPPKIRFLTPIYHPNIDSAGRICLDILKLPPKGAWRPALNISTVLTSIQLLMSEPNPDDPLMADISSEFKYNRAVFFSNAKKWTEKHAL 152          
The following BLAST results are available for this feature:
BLAST of BQ622934 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 267
Match NameE-valueIdentityDescription
UBC2_DICDI4.614e-3142.28Ubiquitin-conjugating enzyme E2 2 OS=Dictyostelium... [more]
UBC2_CANGA6.026e-3140.54Ubiquitin-conjugating enzyme E2 2 OS=Candida glabr... [more]
UBC2_CANAL6.026e-3139.86Ubiquitin-conjugating enzyme E2 2 OS=Candida albic... [more]
UBC2_DEBHA7.870e-3139.33Ubiquitin-conjugating enzyme E2 2 OS=Debaryomyces ... [more]
UBC2_USTMA1.342e-3042.65Ubiquitin-conjugating enzyme E2 2 OS=Ustilago mayd... [more]
UBC1_CAEEL1.342e-3041.67Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditi... [more]
UBC2_YEAST1.753e-3039.86Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces... [more]
UBC2_SCHPO1.753e-3041.13Ubiquitin-conjugating enzyme E2 2 OS=Schizosacchar... [more]
UBC2_ASHGO1.753e-3039.86Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossyp... [more]
UBE2T_XENLA2.290e-3044.90Ubiquitin-conjugating enzyme E2 T OS=Xenopus laevi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00025 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00025 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ622934 ID=BQ622934|Name=BQ622934|organism=Citrus sinensis|type=EST|length=633bp
GAGAGGTCGGGACGGCCAGTAGCTGCCGCAGATCTGCTCCGAAGCCGTTC
CCCTTTCTCACTGCTATTGCCCTCCGATCTCCTTCTTCGCCGCACAAGTG
TTGCAGATCCTAGGTTTGTTGTAGCTTTAACTTTTAATAATCCGTTGAAG
CATCATGGCTTCGAAGCGTATTTTGAAGGAACTCAAGGATTTGCAGAAGG
ATCCTCCCACGTCTTGCAGCGCCGGTCCGGTGGCTGAAGACATGTTCCAC
TGGCAAGCAACAATTATGGGCCCCCCTGATAGTCCATATGCAGGAGGTGT
ATTTTTGGTTACCATTCATTTTCCTCCGGATTATCCCTTCAAGCCCCCAA
AGGTTGCTTTTAGGACCAAGGTCTTCCACCCAAACATCAACAGCAATGGA
AGCATATGTCTTGATATCCTTAAAGAACAGTGGAGCCCAGCTCTTACCAT
TTCAAAGGTCCTGCTTTCTATCTGCTCGTTGCTTACTGACCCAAATCCTG
ACGACCCGCTTGTACCGGAGATTGCTCACATGTACAAGTCCGACAAGGCC
AAATATGAAGCCACTGCCAGGAGCTGGACACAGAAGTATGCCATGGGATA
GTTGGTTTGGATATTGCAGAAATGGAACTCATT
back to top