BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH3_ORYSJ (Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.323e-32
Identity = 67/182 (36.81%), Postives = 101/182 (55.49%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            TT+  +    K L  HP     +  E   I      G + LT    + +  T +V  ES+R+   I  +FR+AV+D+EY+GF IPKGWKV+      H NP+YF+DP  FDP RF+ S  P  ++PFG G   C G +LAKL +++ +H++VT Y W ++  ++ +   P P P  G+  K+
Sbjct:  293 TTASVLTWIVKYLHDHPKLLEAVRAEQAAIRAANDGGRLPLTWAQTRSMALTHKVILESLRMASIISFTFREAVADVEYKGFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFKVSPRPNTFMPFGNGVHACPGNELAKLEMLVLIHHLVTGYRWEIVGSSDEVEYSPFPVPKHGLLAKL 474          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH3_ORYSI (Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.323e-32
Identity = 67/182 (36.81%), Postives = 101/182 (55.49%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            TT+  +    K L  HP     +  E   I      G + LT    + +  T +V  ES+R+   I  +FR+AV+D+EY+GF IPKGWKV+      H NP+YF+DP  FDP RF+ S  P  ++PFG G   C G +LAKL +++ +H++VT Y W ++  ++ +   P P P  G+  K+
Sbjct:  293 TTASVLTWIVKYLHDHPKLLEAVRAEQAAIRAANDGGRLPLTWAQTRSMALTHKVILESLRMASIISFTFREAVADVEYKGFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFKVSPRPNTFMPFGNGVHACPGNELAKLEMLVLIHHLVTGYRWEIVGSSDEVEYSPFPVPKHGLLAKL 474          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH2_ORYSJ (Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.910e-31
Identity = 68/182 (37.36%), Postives = 101/182 (55.49%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNI-MNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            TT+  +    K L   P     +  E + I + N+     LT    + +  T QV  ES+R+   I  +FR+AV+D+EY+GF IPKGWKV+      H NP+YF+DP  FDP RF+ +  P  +LPFG G   C G +LAKL +++ VH +VT Y W ++  ++ +   P P P  G+  K+
Sbjct:  308 TTASVLTWILKYLHDSPKLLEAVKAEQMAIYVANEGGKRPLTWTQTRSMTLTHQVILESLRMASIISFTFREAVADVEYKGFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFKVAPRPSTFLPFGSGVHACPGNELAKLEMLVLVHRLVTAYRWEIVGASDEVEYSPFPVPRGGLNAKL 489          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH2_ORYSI (Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.910e-31
Identity = 68/182 (37.36%), Postives = 101/182 (55.49%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNI-MNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKI 543
            TT+  +    K L   P     +  E + I + N+     LT    + +  T QV  ES+R+   I  +FR+AV+D+EY+GF IPKGWKV+      H NP+YF+DP  FDP RF+ +  P  +LPFG G   C G +LAKL +++ VH +VT Y W ++  ++ +   P P P  G+  K+
Sbjct:  304 TTASVLTWILKYLHDSPKLLEAVKAEQMAIYVANEGGKRPLTWTQTRSMTLTHQVILESLRMASIISFTFREAVADVEYKGFLIPKGWKVMPLFRNIHHNPDYFQDPQKFDPSRFKVAPRPSTFLPFGSGVHACPGNELAKLEMLVLVHRLVTAYRWEIVGASDEVEYSPFPVPRGGLNAKL 485          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: ABAH4_ARATH (Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 3.983e-29
Identity = 60/146 (41.10%), Postives = 87/146 (59.59%), Query Frame = 1
Query:   97 NKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMP 534
            N R  + LT    + +  T +V  ES+R+   I  +FR+AV D+EY+G+ IPKGWKV+      H NP+YF +P  FDP RFE +  P  ++PFG G   C G +LAKL I+IF+H++V+ + W +    + I   P P P  G+P
Sbjct:  315 NSREKKPLTWRQTRNMPLTHKVIVESLRMASIISFTFREAVVDVEYKGYLIPKGWKVMPLFRNIHHNPKYFSNPEVFDPSRFEVNPKPNTFMPFGSGVHACPGNELAKLQILIFLHHLVSNFRWEVKGGEKGIQYSPFPIPQNGLP 460          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP120_SYNY3 (Putative cytochrome P450 120 OS=Synechocystis sp. (strain PCC 6803) GN=cyp120 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 6.793e-29
Identity = 64/187 (34.22%), Postives = 104/187 (55.61%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES-----VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLI-NPNESITMDPLPFPSQGMPIKI 543
            T + A++    +L QH D    + QE     N  +  + LT E +KK+ Y  QV +E +RL PP+ G FR+ + D +++GF  PKGW V +    TH++P+ + DP  FDP RF         PP+ ++PFGGG R C G + A+L + +F   ++ ++DW+L+   N  + + P P P   + +K+
Sbjct:  258 TLTSALSSFCLLLGQHSDIRERVRQEQ----NKLQLSQELTAETLKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLLPGQNLELVVTPSPRPKDNLRVKL 440          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C87A3_ORYSJ (Cytochrome P450 87A3 OS=Oryza sativa subsp. japonica GN=CYP87A3 PE=2 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 4.868e-27
Identity = 66/191 (34.55%), Postives = 106/191 (55.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKR-AGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYV------YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+ A+ +  K+L ++P     L +EH  I+ N++     +T  + K + +T QV  E +RL   + G FRKA+ D+E +G+TIP GW ++      H NPE +EDPL+F+P R++    P +      ++ FGGG R C G  L+K+ +  F+H +VT+Y W  +     +    L FP  G  I++ PK
Sbjct:  326 TTALALTIGVKLLTENPKVVDALREEHEAIIRNRKDPNSGVTWAEYKSMTFTSQVIMEIVRLANIVPGIFRKALQDVEIKGYTIPAGWGIMVCPPAVHLNPEIYEDPLAFNPWRWQGK--PEITGGTKHFMAFGGGLRFCVGTDLSKVLMATFIHSLVTKYSWRTVKGGNIVRTPGLSFP-DGFHIQLFPK 513          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C90B1_ARATH (Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.416e-26
Identity = 69/197 (35.03%), Postives = 108/197 (54.82%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRA-GEI-LTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE-------------SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKIS 546
            T+S AIA+    L   P     L +EH+ I   K+  GE  L  +D KK+ +T  V  E++RL   +    RKA+ D+ Y+G+ IP GWKVL      H +   ++ P  F+P R+++             S     Y+PFGGGPRLCAG +LAKL + +F+H++V +++W L   ++      + FP+ G+PI++S
Sbjct:  315 TSSVAIALAIFFLQACPKAVEELREEHLEIARAKKELGESELNWDDYKKMDFTQCVINETLRLGNVVRFLHRKALKDVRYKGYDIPSGWKVLPVISAVHLDNSRYDQPNLFNPWRWQQQNNGASSSGSGSFSTWGNNYMPFGGGPRLCAGSELAKLEMAVFIHHLVLKFNWELAEDDQPFAFPFVDFPN-GLPIRVS 510          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C90A1_ARATH (Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.416e-26
Identity = 60/160 (37.50%), Postives = 94/160 (58.75%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            TTS  + +  K L + P   + L +EH  I   K     L   D K + +T  V  E++R+   I G FR+A++D+E +G+ IPKGWKV  +    H +P +F+D  +F+P R++ +     P  V+ PFGGGPRLC GY+LA++ + +F+H +VT + W
Sbjct:  282 TTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSDYKSMPFTQCVVNETLRVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNHFKDARTFNPWRWQSNSVTTGPSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSW 441          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAH_ARATH (Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 1.566e-25
Identity = 69/190 (36.32%), Postives = 109/190 (57.37%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRA-GEILTLEDMK-KIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES---VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPKL 555
            +TS   ++  K LA++    + L +EH  I+ N+   G  ++ E+ + ++ +T  V  E++R+       +RKAV+D+E +G+TIP GW V       H N   +E+PL F+P R+E          ++ FGGG R C G + A+L I IF+H++VT YD+SL   +E I   PLP+  +G+PIKIS  L
Sbjct:  289 STSSVTSLAIKFLAENHKALAELKREHAAILQNRNGKGAGVSWEEYRHQMTFTNMVINETLRMANMAPIMYRKAVNDVEIKGYTIPAGWIVAVIPPAVHFNDAIYENPLEFNPWRWEGKELRSGSKTFMVFGGGVRQCVGAEFARLQISIFIHHLVTTYDFSLAQESEFIRA-PLPYFPKGLPIKISQSL 477          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
ABAH3_ORYSJ1.323e-3236.81Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa sub... [more]
ABAH3_ORYSI1.323e-3236.81Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa sub... [more]
ABAH2_ORYSJ1.910e-3137.36Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa sub... [more]
ABAH2_ORYSI1.910e-3137.36Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa sub... [more]
ABAH4_ARATH3.983e-2941.10Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thal... [more]
CP120_SYNY36.793e-2934.22Putative cytochrome P450 120 OS=Synechocystis sp. ... [more]
C87A3_ORYSJ4.868e-2734.55Cytochrome P450 87A3 OS=Oryza sativa subsp. japoni... [more]
C90B1_ARATH1.416e-2635.03Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CY... [more]
C90A1_ARATH1.416e-2637.50Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CY... [more]
THAH_ARATH1.566e-2536.32Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top