BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C13B1_CAEEL (Putative cytochrome P450 cyp-13B1 OS=Caenorhabditis elegans GN=cyp-13B1 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 48/159 (30.19%), Postives = 78/159 (49.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPI-FGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYF-EDPLSFDPRRFEESVPPYV--YLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+ ++A    +LA+HP+   L  +E   ++ +    E ++ +DM K+KY   V RES+RL+P   F   R+ V         I KG K+       H + E + E+   F P R+ E    +   ++PFG GPR C G +L        + +++ RYD
Sbjct:  324 TTANSLAYASYLLAKHPEKMKLAQEEVDTVVGS----ENVSYDDMTKLKYLDAVVRESLRLYPVAWFACSRECVKPTTLGDIYIDKGVKIEADVMSLHRSKEIWGENADDFVPERWLEPSSRHTMSWIPFGAGPRQCVGMRLGLSEAKTALAHLLRRYD 478          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B3_RAT (Cytochrome P450 11B3, mitochondrial OS=Rattus norvegicus GN=Cyp11b3 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 42/156 (26.92%), Postives = 79/156 (50.64%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAV--SDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  + MT   LA++PD    L QE +    +  A     + D+  ++      +E++RL+P   G F + +  SD+  + + +P G  VL   +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+++  +
Sbjct:  318 TTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKAMSDLPLLR---AALKETLRLYP--VGGFLERILNSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTF 468          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B2_RAT (Cytochrome P450 11B2, mitochondrial OS=Rattus norvegicus GN=Cyp11b2 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 42/156 (26.92%), Postives = 79/156 (50.64%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAV--SDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+  + MT   LA++PD    L QE +    +  A     + D+  ++      +E++RL+P   G F + +  SD+  + + +P G  VL   +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+++  +
Sbjct:  328 TTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKAMSDLPLLR---AALKETLRLYP--VGGFLERILNSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTF 478          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B1_RAT (Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 42/156 (26.92%), Postives = 81/156 (51.92%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAV--SDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TT+ ++ MT   LA++PD    L QE +    +  A     + D+  ++      +E++RL+P   GSF + +  SD+  + + +P G  V+   +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+++  +
Sbjct:  317 TTAISLVMTLFELARNPDVQQALRQESLAAEASIVANPQKAMSDLPLLR---AALKETLRLYP--VGSFVERIVHSDLVLQNYHVPAGTFVIIYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTF 467          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C11B1_MESAU (Cytochrome P450 11B1, mitochondrial OS=Mesocricetus auratus GN=CYP11B1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-11
Identity = 41/154 (26.62%), Postives = 77/154 (50.00%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS  + MT   LA++PD    + QE +    +  A     + D+  ++    V +E++RL+P      R   SD+  + + +P G  +  + +    NP  F  P  + P+R+ E    + +L FG G R C G +LA++ +++ +H+V+  +
Sbjct:  317 TTSVPLVMTLFELARNPDVQQAVRQESLAAEASVAANPQRAMSDLPLLR---AVLKETLRLYPVAVFLERILSSDLVLQNYHVPAGTILHMSLYSMGRNPAVFPRPEHYLPQRWLERNGSFQHLTFGFGVRQCLGKRLAQVEMLLLLHHVLKSF 467          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C13B1_CAEEL8.343e-1130.19Putative cytochrome P450 cyp-13B1 OS=Caenorhabditi... [more]
C11B3_RAT8.343e-1126.92Cytochrome P450 11B3, mitochondrial OS=Rattus norv... [more]
C11B2_RAT8.343e-1126.92Cytochrome P450 11B2, mitochondrial OS=Rattus norv... [more]
C11B1_RAT8.343e-1126.92Cytochrome P450 11B1, mitochondrial OS=Rattus norv... [more]
C11B1_MESAU8.343e-1126.62Cytochrome P450 11B1, mitochondrial OS=Mesocricetu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top