BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AL_CALJA (Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.395e-18
Identity = 51/160 (31.87%), Postives = 84/160 (52.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            TTS  ++     LA HPD    L +E   ++ NK      T + + +++Y   V  E++RLFP      R    D+E  G  IPKG  V+  ++  H +P+Y+ +P  F P RF    ++++ PY+Y PFG GPR C G + A +N+ + +  V+  + +
Sbjct:  309 TTSSTLSFIMYELATHPDVQQKLQEEIDAVLPNKAPA---TYDTVLQMEYLDMVVNETLRLFPLAMRLERVCKKDVEINGVFIPKGVVVMIPSYALHYDPKYWTEPEKFLPERFSKNNKDNIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSF 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4D8_DROME (Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 7.046e-18
Identity = 50/162 (30.86%), Postives = 88/162 (54.32%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFT-----IPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEES--VPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+ A++     L++HP+  + +L+E V ++   R+  + ++ D+ ++KY   V +ES+R++PP+    RK  +D +Y         IP G +++   FG H  PE F +P  F P R E    V P+  +PF  GPR C G + A+L + + +  +V  Y+
Sbjct:  271 TTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPV-SIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFPNPDEFIPERHENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYE 431          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AA_RAT (Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a10 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 7.046e-18
Identity = 54/176 (30.68%), Postives = 94/176 (53.41%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP--PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFP 519
            TT+  ++  F  LA HP+      +E  +++ +   G  +T + + +I YT    +E++RL+PP+ G  R+  + + + +G ++PKG +V  + +G H NP+ + +P  FDP RF    P   + +LPF GG R C G Q A   + + V   + R++  L +P    T  P+P P
Sbjct:  324 TTASGVSWIFYALATHPEHQQRCREEVQSVLGD---GSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGIQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRHSHSFLPFSGGARNCIGKQFAMSEMKVIVALTLLRFE-LLPDP----TKVPIPLP 491          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AA_MOUSE (Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.046e-18
Identity = 49/158 (31.01%), Postives = 86/158 (54.43%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP--PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  ++  F  LA HPD      +E  +++ +   G  +T + + +I YT    +E++RL+PP+ G  R+  + + + +G ++PKG +V  + +G H NP+ + +P  FDP RF    P   + +LPF GG R C G Q A   + + V   + R++
Sbjct:  324 TTASGVSWIFYALATHPDHQQRCREEVQSLLGD---GSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPDSPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFE 478          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP46A_MOUSE (Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 7.046e-18
Identity = 53/177 (29.94%), Postives = 93/177 (52.54%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVPP--YVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLI-----NPNESITMDPL 510
            T++  +A T   L++ P+  + L  E   ++ +KR    L  ED+ +++Y  QV +ES+RL+PP +G+FR    +   +G  +P    +L++ +       YFEDPL+F+P RF    P   + Y PF  G R C G Q A++ + + +  ++ R ++ L+        E  T+ PL
Sbjct:  306 TSANHLAFTVMELSRQPEIVARLQAEVDEVVGSKRH---LDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRIEFRLVPGQRFGLQEQATLKPL 479          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A7_HUMAN (Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 7.046e-18
Identity = 50/160 (31.25%), Postives = 84/160 (52.50%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDW 468
            TTS  ++     LA HPD    + +E   ++ NK      T + + +++Y   V  E++RLFP      R    D+E  G  IPKG  V+  ++  H +P+Y+ +P  F P RF    ++++ PY+Y PFG GPR C G + A +N+ + +  V+  + +
Sbjct:  309 TTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPP---TYDTVLQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWREPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSF 465          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AF_CAVPO (Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.203e-18
Identity = 50/147 (34.01%), Postives = 78/147 (53.06%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNI 429
            T+S  ++     LA HPD    L QE    + NK      T + M +++Y   V  E++RL+P      R +  D E  G + PKG  V+  +F  H + +Y+ +P  F P RF    +E++ PY+Y+PFG GPR C G ++A +N+
Sbjct:  309 TSSSTLSCIMYSLATHPDVQKKLHQEIDKTLPNKA---FPTYDVMMEMEYLDMVVNETLRLYPVANRIERMSKKDFEINGMSFPKGTLVMIPSFALHRDSKYWPEPDEFRPERFSKKNKENIDPYIYMPFGNGPRNCIGRRMALMNL 452          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AE_RAT (Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a14 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.202e-17
Identity = 52/158 (32.91%), Postives = 82/158 (51.90%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP--PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+  F  LA HP+      +E  +I+ +   G  +T + + +I YT    +E++RL+PP+    R+  S + + +G +IPKG       +G H NP Y+ +P  FDP RF    P   + YLPF GG R C G Q A   + + V   + R++
Sbjct:  322 TTASGISWVFYALATHPEHQERCREEVQSILGD---GTSVTWDHLDQIPYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRSIPKGITTTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFE 476          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AV_MESAU (Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.202e-17
Identity = 51/158 (32.28%), Postives = 85/158 (53.80%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            TTS  ++    +LA HPD    L QE ++I    +A    + + + +++Y   V  E++RL+P      R    D+E +G  +PKG  V+   F  H +P+Y+ +P  F P RF +    S+ PY++LPFG GPR C G + A +N+ + +  V+  +
Sbjct:  307 TTSSTLSFALYLLATHPDVQKKL-QEEIDIALPNKARP--SYDKVMEMEYLDMVLNETLRLYPIGSRLERVCKQDVEMDGVFVPKGSIVMVPVFALHYDPQYWPEPEKFRPERFSKENKGSIDPYIFLPFGNGPRNCIGMRFALMNMKLALTKVLQNF 461          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AI_RAT (Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.202e-17
Identity = 61/178 (34.27%), Postives = 89/178 (50.00%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQ 525
            TS +I+     LA  P+    L  E    + NK     +T + + +++Y   V  ES+RL+P      R +  D+E  G  IPKG  V    +  H NPEY+ +P  F+P RF +    S+ PYVYLPFG GPR C G + A +++ + V  V+  ++   I P E  T  PL    Q
Sbjct:  310 TSTSISFIMYELATRPNVQKKLQNEIDRALPNKAP---VTYDALMEMEYLDMVVNESLRLYPIATRLDRVSKKDVEINGVFIPKGTVVTIPIYPLHRNPEYWLEPEEFNPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALISMKLAVIGVLQNFN---IQPCEK-TQIPLKISRQ 480          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP3AL_CALJA5.395e-1831.88Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3... [more]
CP4D8_DROME7.046e-1830.86Cytochrome P450 4d8 OS=Drosophila melanogaster GN=... [more]
CP4AA_RAT7.046e-1830.68Cytochrome P450 4A10 OS=Rattus norvegicus GN=Cyp4a... [more]
CP4AA_MOUSE7.046e-1831.01Cytochrome P450 4A10 OS=Mus musculus GN=Cyp4a10 PE... [more]
CP46A_MOUSE7.046e-1829.94Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp4... [more]
CP3A7_HUMAN7.046e-1831.25Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1... [more]
CP3AF_CAVPO9.203e-1834.01Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15... [more]
CP4AE_RAT1.202e-1732.91Cytochrome P450 4A14 OS=Rattus norvegicus GN=Cyp4a... [more]
CP3AV_MESAU1.202e-1732.28Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CY... [more]
CP3AI_RAT1.202e-1734.27Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top