BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4A2_RAT (Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2 PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.570e-17
Identity = 57/176 (32.39%), Postives = 91/176 (51.70%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEESVP--PYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFP 519
            TT+  I+  F  LA HP+      +E  +I+ +   G  +T + + ++ YT    +E++RL+ P+    R+  S + + +G +IPKG +V    +G H NP Y+ +P  FDP RF    P   + YLPF GG R C G Q A   + + V   + R++  L +P    T  P+P P
Sbjct:  319 TTASGISWVFYALATHPEHQERCREEVQSILGD---GTSVTWDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGRSIPKGIRVTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFE-LLPDP----TRIPVPMP 486          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A1_RAT (Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.678e-17
Identity = 55/180 (30.56%), Postives = 88/180 (48.89%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TS  ++     LA HPD    L +E    + NK      T + + +++Y   V  E++RL+P      R    D+E  G  +PKG  V+  ++  H +P+++ +P  F P RF +    S+ PYVYLPFG GPR C G + A +N+ + +  V+  + +         T  PL    QG+
Sbjct:  311 TSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPP---TYDTVMEMEYLDMVLNETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKE----TQIPLKLSRQGL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_MOUSE (Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 3.497e-17
Identity = 55/148 (37.16%), Postives = 79/148 (53.38%), Query Frame = 1
Query:   34 MLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGT-HSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            +LA HPDC   LL+E    M    A E  +L++   + Y   V  E++R++PP F   R+A  D E  G  IP G  VL  A G  H +PE++ +P +FDP RF         P+ YLPFG GPR C G +L  L + + +  V+ ++
Sbjct:  356 LLATHPDCQERLLKEVDLFMGKHPAPEYHSLQE--GLPYLDMVISETLRMYPPAFRFTREAAQDCEVLGQRIPAG-TVLEIAVGALHHDPEHWPNPETFDPERFTAEARLQRRPFTYLPFGAGPRSCLGVRLGLLVVKLTILQVLHKF 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3A2_RAT (Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 4.567e-17
Identity = 55/191 (28.80%), Postives = 93/191 (48.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            TTS  ++     LA HPD    L +E    + +K      T + + +++Y   V  E++RL+P      R    DIE +G  IPKG  V    +  H +P+++  P  F P RF +    S+ PYVYLPFG GPR C G + A +N+ + +  V+  + +      +    ++   +  P + + +K+ P+
Sbjct:  310 TTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPP---TYDIVMEMEYLDMVLNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQAILEPEKPIVLKVLPR 497          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP341_MOUSE (Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.567e-17
Identity = 55/181 (30.39%), Postives = 89/181 (49.17%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS  ++ T   LA HPD    L +E    + NK      T + + +++Y   V  E++RL+P      R    D+E  G  IPKG  V+  ++  H +P+++ +P  F P RF +    S+ PY+Y+PFG GPR C G + A + + + +  V+  + +         T  PL    QG+
Sbjct:  310 TTSSTLSFTLYCLATHPDIQKKLQEEIDETLPNKAPP---TYDTVMEMEYLDMVLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKENKGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQE----TQIPLKLSRQGL 483          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: THAS_RAT (Thromboxane-A synthase OS=Rattus norvegicus GN=Tbxas1 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 55/158 (34.81%), Postives = 82/158 (51.90%), Query Frame = 1
Query:    4 TSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGT-HSNPEYFEDPLSFDPRRFEESV----PPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            T+  ++    +LA HP+C   LL+E    M    A E   L++   + Y   V  E++R++PP F   R+A  D E  G  IP G  VL  A G  H +PE++ +P +FDP RF         P+ YLPFG GPR C G +L  L + + +  V+ ++
Sbjct:  346 TTNTLSFITYLLATHPECQERLLKEVDLFMEKHPAPEYCNLQE--GLPYLDMVVAETLRMYPPAFRFTREAAQDCEVLGQHIPAG-SVLEIAVGALHHDPEHWPNPETFDPERFTAEARLQQKPFTYLPFGAGPRSCLGVRLGLLVVKLTLLQVLHKF 500          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4CU_BLAGE (Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 51/167 (30.54%), Postives = 80/167 (47.90%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE 489
            T S A+      L  HP+      +E  +I     +  + T+ D+  + Y  +V +ES+RL P +    R+A  D E  G+TIP G  + ++    H NPE F +P  F+P  F      +  PY Y+PF  GPR C G + A L   + + Y++  Y +  +N  E
Sbjct:  313 TVSAAMTWLLFELGHHPEIQEEAYKEVQDIFQG--SDRVPTMADLNNMNYLERVIKESLRLHPSVIYFVREAHQDFELGGYTIPAGTNIDFSVPFIHRNPEIFPNPRCFNPDNFLPDRVVNRHPYAYIPFSAGPRNCIGQRFALLEEKVVLSYLLRHYRFRTVNKRE 477          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AE_MOUSE (Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 50/158 (31.65%), Postives = 84/158 (53.16%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+  F  LA HP+      +E  +I+ +   G  +T + + ++ YT    +E++RL+PP+    R+  S + + +G +IPKG     + +G H NP ++ +P  FDP RF  + S   + YLPF GG R C G Q A   + + V   + R++
Sbjct:  322 TTASGISWIFYALATHPEHQQRCREEVQSILGD---GTSVTWDHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGRSIPKGITATISIYGLHHNPRFWPNPKVFDPSRFAPDSSHHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFE 476          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AA_MESAU (Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 5.965e-17
Identity = 53/158 (33.54%), Postives = 81/158 (51.27%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRY 462
            +TS +I +    LA HPD    L  E  + + NK     +T + +  ++Y   V  E +RL+P      R +   +E  G  IPKG  V+   +  H +PEY+ +P  F P RF +    S+ PYVY+PFG GPR C G + A L++ + V  V+  +
Sbjct:  309 STSTSICLVLYELATHPDVQKKLHDEIDSALPNKAP---VTYDVLMGMEYLDMVINEGLRLYPIANRLERISKKAVEINGLFIPKGITVMVPTYPLHRDPEYWPEPEEFRPERFSKENKGSIDPYVYMPFGNGPRNCIGMRFALLSMKLAVVSVLQNF 463          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4V3_RAT (Cytochrome P450 4V3 OS=Rattus norvegicus GN=Cyp4v3 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.791e-17
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLA 417
            TT+ AI  +  +L  +P+    + +E  ++    R+   +TLED+KK+KY   V +E++R+FP +    R    D E  G+ I KG + +   +  H +P YF DP  F P RF     +   PY Y+PF  GPR C G + A
Sbjct:  333 TTAAAINWSLYLLGSNPEVQRKVDKELDDVFG--RSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARSLSEDCEVAGYKISKGTEAVIIPYALHRDPRYFPDPEEFQPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFA 473          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
CP4A2_RAT1.570e-1732.39Cytochrome P450 4A2 OS=Rattus norvegicus GN=Cyp4a2... [more]
CP3A1_RAT2.678e-1730.56Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1... [more]
THAS_MOUSE3.497e-1737.16Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 P... [more]
CP3A2_RAT4.567e-1728.80Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2... [more]
CP341_MOUSE4.567e-1730.39Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a P... [more]
THAS_RAT5.965e-1734.81Thromboxane-A synthase OS=Rattus norvegicus GN=Tbx... [more]
CP4CU_BLAGE5.965e-1730.54Cytochrome P450 4c21 OS=Blattella germanica GN=CYP... [more]
CP4AE_MOUSE5.965e-1731.65Cytochrome P450 4A14 OS=Mus musculus GN=Cyp4a14 PE... [more]
CP3AA_MESAU5.965e-1733.54Lithocholate 6-beta-hydroxylase OS=Mesocricetus au... [more]
CP4V3_RAT7.791e-1734.27Cytochrome P450 4V3 OS=Rattus norvegicus GN=Cyp4v3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top