BQ623089

Overview
NameBQ623089
Unique NameBQ623089
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C340_ORYLA (Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.866e-16
Identity = 58/191 (30.37%), Postives = 94/191 (49.21%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE-SITMDPLPF--PSQGMPIKISPK 552
            TTS ++      LA +P+    L +E      NK   + + L +M+   Y   V  ES+RL+P      R A + +E  G  IPK   V+   +  H +PE + +P  F P RF    +++  PY Y+PFG GPR C G + A + + + V  ++  YD+S+    E    MD   F  P + + +K++P+
Sbjct:  310 TTSSSLTFLAYNLATNPEVMKKLQKEIDATFPNKAPVQYVPLMEME---YLDCVVNESLRLYPIAARLERVAKATVEVNGLVIPKDMVVMVPTWPLHRDPELWPEPEKFKPERFSKENKDTFDPYTYMPFGAGPRNCIGMRFALVMMKLAVVEILQTYDFSVCKETEVPFEMDVQGFLAPKRPIQLKLTPR 497          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP9E2_BLAGE (Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9E2 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 50/167 (29.94%), Postives = 88/167 (52.69%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYE---GFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLIN 480
            T S  +     +LA +PD  + L Q+ ++    +  G+ LT E +  +KY   V  ES+RL+PP   + RK V +        +T+  G  V    +  H +P+Y+ +P  FDP RF    ++++ P+ YLPFG GPR C G + A +   I + +++ R++  +++
Sbjct:  338 TASTLLCFMSHLLATNPDVQNRL-QDEIDQSLEENDGK-LTYEAIHSMKYLDMVVSESLRLYPPAIFTDRKCVKNYRLPMEPSYTLEPGDAVWIPIYAIHHDPKYYPNPEKFDPERFSDENKDNIKPFTYLPFGSGPRNCIGNRFALMESKIALVHLLCRFNLKVVS 502          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4AC_RAT (Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a12 PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 54/176 (30.68%), Postives = 93/176 (52.84%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF--EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFP 519
            TT+  I+  F  LA +P+      +E  +++ +   G  +T +D+ K+ YT    +E++R++PP+    R   + + + +G ++PKG  V+ + +G H NP  + +P  FDP RF  E S   + +LPF GG R C G Q A   + + V   + R++  L +P    T  P+P P
Sbjct:  323 TTASGISWIFYALATNPEHQQGCRKEIQSLLGD---GASITWDDLDKMPYTTMCIKEALRIYPPVTAVSRMLSTPVTFPDGRSLPKGITVMLSFYGLHHNPTVWPNPEVFDPYRFAPESSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFE-LLPDP----TRIPIPIP 490          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4A7_RABIT (Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CYP4A7 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  I+  F  LA HP+      +E   ++ +   G  +T E + K+ YT    +E++RL+PP+ G   K  S + + +G ++PKG  +  + +G H NP+ + +P  FDP RF    +   + +LPF GG R C G Q A   + + V   + R++
Sbjct:  326 TTASGISWIFYALATHPEHQHRCREEIQGLLGD---GASITWEHLDKMPYTTMCIKEALRLYPPVPGVGSKLSSPVTFPDGRSLPKGIIITLSIYGLHHNPKVWPNPEVFDPSRFAPGSARHSHAFLPFSGGSRNCIGKQFAMNELKVAVALTLVRFE 480          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4D21_DROME (Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 49/189 (25.93%), Postives = 89/189 (47.09%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFEE-----SVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGMPIKISPK 552
            TT+  ++     +++HP     + +E V+++       + T   + ++KY   V +E+MRL PP+    R    D++    TIP    +L   +  + +PEYF DPL F P R+ +     + PP  Y+PF  GP+ C G + A L +   +  V+  Y+   +  +   T   +   S G  + + P+
Sbjct:  320 TTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASV-TQTKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEYFPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELLPLGADLKATYTFILSSSTGNNVGLKPR 507          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C4D14_DROME (Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 6.595e-16
Identity = 51/161 (31.68%), Postives = 86/161 (53.42%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFP--PIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+ +IA T  +LA+HP+  + + QE  +++ + ++  + T++ + ++KY   V +ES+RLFP  PI G  R    D   +G  IP    V+   +    +P+YF DP  F P RF    +  + P+ Y PF  GPR C G + A L +   +  +V  ++
Sbjct:  319 TTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPV-TMKLLGELKYLECVIKESLRLFPSVPIIG--RYISQDTVLDGKLIPADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFE 476          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP3AC_CANFA (Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A12 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.613e-16
Identity = 56/181 (30.94%), Postives = 87/181 (48.07%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFPSQGM 531
            TTS +++     LA HPD    L +E      NK    + T + + +++Y   V  E++RL+P      R    D+E  G  IPKG  V+   F  H +   + +P  F P RF    ++S+ PY YLPFG GPR C G + A +N+ + +  V+  + +         T  PL   +QG+
Sbjct:  309 TTSTSLSFLMYELATHPDVQQKLQEEIDATFPNKA---LPTYDALVQMEYLDMVLNETLRLYPIAGRLERVCKKDVEISGVFIPKGTVVMVPTFTLHRDQSLWPEPEEFRPERFSRKNKDSINPYTYLPFGTGPRNCIGMRFAIMNMKLALVRVLQNFSFKPCKE----TQIPLKLNAQGI 482          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4CA_MOUSE (Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.125e-15
Identity = 54/176 (30.68%), Postives = 92/176 (52.27%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNESITMDPLPFP 519
            TT+  I+  F  LA +P+      +E  +++ +   G  +T  D+ K+ YT    +E++R++PP+    R+  S + + +G ++PKG  V+ + +G H NP  + +P  FDP RF    S   + +LPF GG R C G Q A   + + V   + R++  L +P    T  P+P P
Sbjct:  323 TTASGISWIFYALATNPEHQQRCRKEIQSLLGD---GTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFE-LLPDP----TRVPIPIP 490          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: CP4A5_RABIT (Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CYP4A5 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.125e-15
Identity = 48/158 (30.38%), Postives = 82/158 (51.90%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEY-EGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRFE--ESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYD 465
            TT+  ++  F  LA HP+      +E   ++ +   G  +T E + ++ YT    +E+MRL+PP+    R   S + + +G ++PKG+ V  + +G H NP  + +P  FDP RF    +   + +LPF GG R C G Q A   + + V   + R++
Sbjct:  326 TTASGVSWIFYALATHPEHQHRCREEIQGLLGD---GASITWEHLDQMPYTTMCIKEAMRLYPPVPAISRDLSSPVTFPDGRSLPKGFTVTLSIYGLHHNPNVWPNPEVFDPGRFTPGSARHSHAFLPFSGGARNCIGKQFAMNELKVAVALTLVRFE 480          
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Match: C356_FUNHE (Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.125e-15
Identity = 56/191 (29.32%), Postives = 94/191 (49.21%), Query Frame = 1
Query:    1 TTSFAIAMTFKMLAQHPDCYSLLLQEHVNIMNNKRAGEILTLEDMKKIKYTWQVARESMRLFPPIFGSFRKAVSDIEYEGFTIPKGWKVLWTAFGTHSNPEYFEDPLSFDPRRF----EESVPPYVYLPFGGGPRLCAGYQLAKLNIIIFVHYVVTRYDWSLINPNE---SITMDPLPFPSQGMPIKISPK 552
            T+S ++      LA +P+    L +E      NK       L +M+   Y   V  ES+RLFP      R A + +E  G  IPK   V+   +  H +PE + +P +F P RF    ++++ PY+Y+PFG GPR C G + A + I + V  ++ +Y +S+    E    + +  L  P + + +K+ P+
Sbjct:  308 TSSSSLTFLAYNLATNPEVMKKLQEEIDATFPNKAPVHYQPLMEME---YLDCVINESLRLFPIAARLERVAKAAVEINGIVIPKDMVVMIPTWPLHRDPEIWPEPEAFKPERFSKKNKDNIDPYIYMPFGSGPRNCIGMRFALVLIKLAVVEILQQYSFSVCKETEVPFEMDIQGLLAPKRPIQLKLVPR 495          
The following BLAST results are available for this feature:
BLAST of BQ623089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 275
Match NameE-valueIdentityDescription
C340_ORYLA3.866e-1630.37Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40... [more]
CP9E2_BLAGE6.595e-1629.94Cytochrome P450 9e2 OS=Blattella germanica GN=CYP9... [more]
CP4AC_RAT6.595e-1630.68Cytochrome P450 4A12 OS=Rattus norvegicus GN=Cyp4a... [more]
CP4A7_RABIT6.595e-1631.01Cytochrome P450 4A7 OS=Oryctolagus cuniculus GN=CY... [more]
C4D21_DROME6.595e-1625.93Probable cytochrome P450 4d21 OS=Drosophila melano... [more]
C4D14_DROME6.595e-1631.68Probable cytochrome P450 4d14 OS=Drosophila melano... [more]
CP3AC_CANFA8.613e-1630.94Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A1... [more]
CP4CA_MOUSE1.125e-1530.68Cytochrome P450 4A12A OS=Mus musculus GN=Cyp4a12a ... [more]
CP4A5_RABIT1.125e-1530.38Cytochrome P450 4A5 OS=Oryctolagus cuniculus GN=CY... [more]
C356_FUNHE1.125e-1529.32Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00180 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00180 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623089 ID=BQ623089|Name=BQ623089|organism=Citrus sinensis|type=EST|length=604bp
ACCACATCTTTTGCCATTGCCATGACGTTTAAGATGTTAGCGCAGCATCC
AGATTGCTATTCTCTCCTCCTACAAGAACATGTTAACATAATGAATAATA
AAAGAGCTGGCGAAATTCTAACACTGGAAGACATGAAGAAGATAAAATAC
ACCTGGCAAGTTGCTCGCGAAAGCATGCGGCTCTTCCCTCCCATCTTCGG
CTCCTTCAGAAAAGCAGTTTCTGACATTGAGTATGAGGGATTCACCATTC
CTAAAGGCTGGAAGGTTTTATGGACAGCATTTGGAACACATTCGAATCCG
GAGTATTTTGAAGATCCTCTGAGTTTCGATCCCAGAAGGTTCGAGGAATC
AGTGCCTCCATATGTCTATCTTCCATTCGGAGGAGGGCCAAGATTGTGCG
CAGGCTACCAACTGGCCAAGCTAAACATCATCATCTTTGTTCATTATGTT
GTAACTCGCTATGATTGGTCTTTAATTAATCCCAACGAGTCAATCACCAT
GGATCCTCTCCCATTTCCTTCCCAAGGAATGCCCATCAAGATTTCTCCCA
AGTTGTAAACAACCAGCAATACGGCTGGGATTTTTCCTTACATAATTATG
TTGG
back to top