BQ623098

Overview
NameBQ623098
Unique NameBQ623098
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length611
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3096 contig Csv1_Contig3096:616..1227. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALDOB_SHEEP (Fructose-bisphosphate aldolase B OS=Ovis aries GN=ALDOB PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 8.825e-46
Identity = 87/160 (54.37%), Postives = 108/160 (67.50%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIP--CGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGL+ R  +Y K GA F KWR V+ I   C PS LA++E A  LARYA+I Q NGLVPIVEPE++ DG H +E    V EKV + V+  L +++V LEG LLKP+MVT G    +K +PE +A  T+T L R VP AVPGI FLSGG SE +A
Sbjct:  122 ETTVQGLDGLSERCAQYKKDGADFGKWRAVLKIDNQC-PSHLAIQENANTLARYASIYQQNGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDA 280          

HSP 2 Score: 50.0618 bits (118), Expect = 8.825e-46
Identity = 24/46 (52.17%), Postives = 30/46 (65.22%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNA+N  P   PW +SF Y RALQ + L  W G+ EN +A Q
Sbjct:  280 ATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAENKKATQ 325          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALDOB_BOVIN (Fructose-bisphosphate aldolase B OS=Bos taurus GN=ALDOB PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.953e-45
Identity = 87/160 (54.37%), Postives = 108/160 (67.50%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIP--CGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGL+ R  +Y K GA F KWR V+ I   C PS LA++E A  LARYA+I Q NGLVPIVEPE++ DG H +E    V EKV + V+  L +++V LEG LLKP+MVT G    +K +PE +A  T+T L R VP AVPGI FLSGG SE +A
Sbjct:  122 ETTVQGLDGLSERCAQYKKDGADFGKWRAVLKIDNQC-PSHLAIQENANTLARYASICQQNGLVPIVEPEVIPDGSHDMEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDA 280          

HSP 2 Score: 48.521 bits (114), Expect = 1.953e-45
Identity = 23/46 (50.00%), Postives = 29/46 (63.04%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNA+N  P   PW +SF Y RALQ + L  W G+ EN +  Q
Sbjct:  280 ATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAENKKTTQ 325          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.546e-45
Identity = 89/159 (55.97%), Postives = 110/159 (69.18%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIP-CGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGL+ R  +Y K GA FAKWR+V+ I    PS LA+ E A  LARYA+I Q NG+VPIVEPEIL DG+H ++R   V EKV +  +  L++++V LEG LLKP+MVT G     K S E IA  T+T L+R VPPAV G+ FLSGGQSE EA
Sbjct:  122 ETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSSEEIAMATVTALRRTVPPAVSGVTFLSGGQSEEEA 280          

HSP 2 Score: 43.5134 bits (101), Expect = 2.546e-45
Identity = 19/45 (42.22%), Postives = 29/45 (64.44%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAA 604
            +++NLN++N  P   PW ++F Y RALQ + L  W+G   N +AA
Sbjct:  280 ASVNLNSINNCPLAKPWPLTFSYGRALQASALSAWRGAKSNEKAA 324          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALDOB_RAT (Fructose-bisphosphate aldolase B OS=Rattus norvegicus GN=Aldob PE=1 SV=2)

HSP 1 Score: 155.606 bits (392), Expect = 9.569e-45
Identity = 86/160 (53.75%), Postives = 109/160 (68.12%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIP--CGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGL+ R  +Y K G  F KWR V+ I   C PS+LA++E A  LARYA+I Q NGLVPIVEPE+L DGDH +E    V+EKV + V+  L +++V LEG LLKP+M+T G    +K +PE +A  T+T L R VP AVP I FLSGG SE +A
Sbjct:  122 ETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRISDQC-PSSLAIQENANALARYASICQQNGLVPIVEPEVLPDGDHDLEHCQYVSEKVLAAVYKALNDHHVYLEGTLLKPNMLTAGHACTKKYTPEQVAMATVTALHRTVPAAVPSICFLSGGMSEEDA 280          

HSP 2 Score: 45.8246 bits (107), Expect = 9.569e-45
Identity = 22/46 (47.83%), Postives = 29/46 (63.04%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            +TLNLNA+ + P   PW +SF Y RALQ + L  W G+  N +A Q
Sbjct:  280 ATLNLNAIYRCPLPRPWKLSFSYGRALQASALAAWGGKAANKKATQ 325          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALDCA_DANRE (Fructose-bisphosphate aldolase C-A OS=Danio rerio GN=aldoca PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.118e-44
Identity = 87/159 (54.72%), Postives = 109/159 (68.55%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIP-CGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QGLDGL+ R  +Y K GA FAKWR V+ I    PS L + E A  LARYA+I Q +G+VPIVEPEIL DGDH ++R   V E+V + V+  + +++V LEG LLKP+MVTPG     K S E +A  T+T L+R VPPAV G+ FLSGGQSE EA
Sbjct:  122 ETATQGLDGLSERCAQYKKDGADFAKWRCVMKISETTPSNLCITENAKVLARYASICQQHGIVPIVEPEILPDGDHNLKRCQFVTERVLAAVYKAMFDHHVYLEGTLLKPNMVTPGHGCPTKYSAEEVAMATVTALRRTVPPAVTGVTFLSGGQSEEEA 280          

HSP 2 Score: 43.5134 bits (101), Expect = 2.118e-44
Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAA 604
            +++NL+A+N      PW ++F + RALQ + LKTW+G+ EN  AA
Sbjct:  280 ASINLSAINNCRLVKPWALTFSFGRALQASALKTWRGQRENEAAA 324          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF_TRYBB (Fructose-bisphosphate aldolase, glycosomal OS=Trypanosoma brucei brucei GN=ALD PE=1 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 2.990e-43
Identity = 83/159 (52.20%), Postives = 100/159 (62.89%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCGP-SALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E    GLDG   R+ +YY  G RF KWR V  I  G  S   V+  A  LARYA +SQ  GLVPIVEPE+++DG H IE    V++ VWSEV   L  + VV EG LLKP+MV PGAE   K   E +A+YT+  L R +PPA+PG+ FLSGG SEV A
Sbjct:  132 EQMTAGLDGYIKRAKKYYAMGCRFCKWRNVYKIQNGTVSEAVVRFNAETLARYAILSQLCGLVPIVEPEVMIDGTHDIETCQRVSQHVWSEVVSALHRHGVVWEGCLLKPNMVVPGAESGLKGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMA 290          

HSP 2 Score: 45.0542 bits (105), Expect = 2.990e-43
Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = 2
Query:  488 LNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAAQ 607
            LNAMN  P   PW ++F YARALQ++ +K W G+    EA +
Sbjct:  294 LNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGR 335          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 6.625e-43
Identity = 78/155 (50.32%), Postives = 106/155 (68.39%), Query Frame = 3
Query:   18 QGLDGLASRSTEYYKQGARFAKWRTVVSIPCG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            +GLDGL +R  EYYK GARFAKWR V++I    PS + +      LARYAA+ Q+ GLVP+VEPE+++DG+H I    EV E     +F  L E NVVLEG +LK SMV PG + +E+AS + +A+ T+  LK  VP  +PGI+FLSGGQ++ ++
Sbjct:  115 EGLDGLRARLEEYYKLGARFAKWRAVINIGDDIPSGMCIDANVHALARYAALCQEQGLVPMVEPEVIMDGNHDISAAYEVTEATLRSLFNALYEQNVVLEGTILKASMVIPGTDCEEQASIDEVAESTVMCLKSTVPAILPGIVFLSGGQTDAQS 269          

HSP 2 Score: 41.9726 bits (97), Expect = 6.625e-43
Identity = 20/34 (58.82%), Postives = 23/34 (67.65%), Query Frame = 2
Query:  476 STLNLNAMNQA-PNPWHVSFFYARALQNTVLKTW 574
            ST +LNAMNQ  P PW +SF Y RA+Q   LK W
Sbjct:  269 STAHLNAMNQLDPLPWPLSFSYGRAMQQAALKLW 302          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 8.633e-43
Identity = 78/155 (50.32%), Postives = 106/155 (68.39%), Query Frame = 3
Query:   18 QGLDGLASRSTEYYKQGARFAKWRTVVSIPCG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            +GLDGL +R  EYYK GARFAKWR V++I    PS + +      LARYAA+ Q+ GLVP+VEPE+++DG+H I    EV E     +F  L E NVVLEG +LK SMV PG + +E+AS + +A+ T+  LK  VP  +PGI+FLSGGQ++ ++
Sbjct:  115 EGLDGLRARLEEYYKLGARFAKWRAVINIGDDIPSGMCIDANVHALARYAALCQEQGLVPMVEPEVIMDGNHDISAAYEVTEATLRSLFNALYEQNVVLEGTILKASMVIPGTDCEEQASIDEVAESTVMCLKSTVPAILPGIVFLSGGQTDAQS 269          

HSP 2 Score: 41.5874 bits (96), Expect = 8.633e-43
Identity = 20/34 (58.82%), Postives = 23/34 (67.65%), Query Frame = 2
Query:  476 STLNLNAMNQA-PNPWHVSFFYARALQNTVLKTW 574
            ST +LNAMNQ  P PW +SF Y RA+Q   LK W
Sbjct:  269 STAHLNAMNQFDPLPWPLSFSYGRAMQQAALKLW 302          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 143.28 bits (360), Expect = 5.501e-42
Identity = 83/160 (51.88%), Postives = 106/160 (66.25%), Query Frame = 3
Query:    3 NESWCQGLDGLASRSTEYYKQGARFAKWRTVVSIPCG-PSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            +E   QGLD LA+R  +Y K G  FAKWR V+ I    PS  ++ E A  LARYA+I Q   +VPIVEPE+L DGDH ++R  +V E V + V+  L++++V LEG LLKP+MVT G   K K +PE IA  T+  L+R VP AV G+ FLSGGQSE EA
Sbjct:  121 DEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAK-KNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEA 279          

HSP 2 Score: 48.9062 bits (115), Expect = 5.501e-42
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  476 STLNLNAMNQAP--NPWHVSFFYARALQNTVLKTWQGRPENTEAAQS 610
            +T+NL+A+N  P   PW ++F Y RALQ +VL+ W G+ EN  A Q+
Sbjct:  279 ATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQN 325          
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 170.244 bits (430), Expect = 7.153e-42
Identity = 94/159 (59.12%), Postives = 115/159 (72.33%), Query Frame = 3
Query:    6 ESWCQGLDGLASRSTEYYKQGARFAKWRTVVSI-PCGPSALAVKEAAWGLARYAAISQDNGLVPIVEPEILLDGDHPIERTLEVAEKVWSEVFFYLAENNVVLEGILLKPSMVTPGAEHKEKASPETIAKYTLTMLKRRVPPAVPGIMFLSGGQSEVEA 479
            E+  QG D L  R  +YY+ GARFAKWR V+ I P  PS LA+   A GLARYA I Q+NGLVPIVEPEIL+DG H I+R   V+E V +  +  L E++V+LEG LLKP+MVTPG++ K K SPE IA+YT+  L+R VP AVP I+FLSGGQSE EA
Sbjct:  117 ETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAK-KVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEA 274          
The following BLAST results are available for this feature:
BLAST of BQ623098 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALDOB_SHEEP8.825e-4654.38Fructose-bisphosphate aldolase B OS=Ovis aries GN=... [more]
ALDOB_BOVIN1.953e-4554.38Fructose-bisphosphate aldolase B OS=Bos taurus GN=... [more]
ALDCB_DANRE2.546e-4555.97Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]
ALDOB_RAT9.569e-4553.75Fructose-bisphosphate aldolase B OS=Rattus norvegi... [more]
ALDCA_DANRE2.118e-4454.72Fructose-bisphosphate aldolase C-A OS=Danio rerio ... [more]
ALF_TRYBB2.990e-4352.20Fructose-bisphosphate aldolase, glycosomal OS=Tryp... [more]
ALF1_XYLFA6.625e-4350.32Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XYLFT8.633e-4350.32Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF_DROME5.501e-4251.88Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALF_ORYSJ7.153e-4259.12Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00189 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00189 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623098 ID=BQ623098|Name=BQ623098|organism=Citrus sinensis|type=EST|length=611bp
ACAATGAATCGTGGTGCCAAGGCTTGGATGGATTGGCATCAAGATCCACT
GAATACTACAAGCAAGGTGCTCGATTTGCTAAGTGGAGGACAGTTGTTAG
CATTCCATGTGGTCCTTCTGCTCTGGCTGTGAAGGAAGCTGCATGGGGCC
TTGCACGATATGCTGCTATTTCTCAGGATAATGGACTTGTGCCTATAGTG
GAACCCGAGATCCTTCTTGATGGGGACCACCCAATTGAGAGGACCCTTGA
AGTGGCAGAAAAGGTCTGGTCAGAAGTCTTTTTCTACTTGGCAGAAAACA
ATGTCGTTCTTGAGGGAATTCTACTTAAACCCAGCATGGTCACGCCAGGT
GCTGAACACAAGGAGAAGGCCTCTCCAGAGACCATTGCTAAATATACACT
TACAATGCTCAAGAGGAGAGTACCCCCTGCAGTCCCAGGAATCATGTTTT
TGTCTGGAGGACAATCAGAAGTGGAAGCACATTGAACTTGAATGCGATGA
ACCAAGCCCCCAACCCCTGGCACGTGTCCTTTTTTTATGCCCGTGCACTT
CAAAACACTGTTCTTAAAACATGGCAAGGTCGTCCTGAGAATACTGAAGC
TGCCCAAAGTC
back to top