BQ623117

Overview
NameBQ623117
Unique NameBQ623117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length522
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4747 contig Csv1_Contig4747:19..540. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_DROME (Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=Su(var)3-9 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.576e-26
Identity = 50/76 (65.79%), Postives = 61/76 (80.26%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  +V KL K EIL++NIGS+STG R+ A K DLAK+ LT+PVCT +GEKIALSRRVE HWRLIGWGQI  G T+
Sbjct:  389 KKGARVEKLQKNEILLVNIGSLSTGGRISATKGDLAKIVLTTPVCTEKGEKIALSRRVENHWRLIGWGQIFGGKTI 464          

HSP 2 Score: 28.8758 bits (63), Expect = 8.576e-26
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            +++LLRRLLGVRT G +K  +
Sbjct:  373 SYYLLRRLLGVRTDGDKKGAR 393          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_SCHPO (Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe GN=tif213 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.468e-24
Identity = 49/74 (66.22%), Postives = 59/74 (79.73%), Query Frame = 1
Query:   64 KVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTLDV 285
            KV KLAK E+LM+NIGS STG RV+ VK D+AK+ LT+P CT  GEK+ALSRR+EKHWRLIGW ++  G TL V
Sbjct:  373 KVQKLAKNEVLMVNIGSTSTGGRVMMVKADMAKILLTAPACTEIGEKVALSRRIEKHWRLIGWAKVVEGKTLKV 446          

HSP 2 Score: 25.409 bits (54), Expect = 4.468e-24
Identity = 10/13 (76.92%), Postives = 13/13 (100.00%), Query Frame = 3
Query:    3 NFFLLRRLLGVRT 41
            N+FLLRRLLGV++
Sbjct:  354 NYFLLRRLLGVKS 366          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_RABIT (Eukaryotic translation initiation factor 2 subunit 3 (Fragments) OS=Oryctolagus cuniculus GN=EIF2S3 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 3.221e-12
Identity = 35/59 (59.32%), Postives = 45/59 (76.27%), Query Frame = 1
Query:   88 EILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQ 264
            E+ ++NIGS+STG +V AVK DL K+ LT+PV T  GE+    + VEKHWRLIGWGQI+
Sbjct:   98 ELXIVNIGSLSTGGQVSAVKADLGKIVLTNPVXTEVGEE----KSVEKHWRLIGWGQIR 152          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_META3 (Translation initiation factor 2 subunit gamma OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eIF2G PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.075e-11
Identity = 29/72 (40.28%), Postives = 48/72 (66.67%), Query Frame = 1
Query:   49 SERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQ 264
            S+ +  +S L   E LMLN+G+ +T   + + + D+A ++L  P+C  +G++IA+SRR+   WRLIG+G IQ
Sbjct:  339 SDEELIISPLKSNEALMLNVGTATTVGIITSARGDMADMKLKLPICADKGDRIAMSRRIGSRWRLIGYGIIQ 410          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_ENCCU (Eukaryotic translation initiation factor 2 subunit gamma OS=Encephalitozoon cuniculi GN=ECU01_0700 PE=3 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 6.075e-11
Identity = 30/71 (42.25%), Postives = 46/71 (64.79%), Query Frame = 1
Query:   70 SKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTLD 282
            SKL + E ++LNIGS +TG+ +  +     +  L  P C   GE+IA+SR++  HWRLIG G+I+ GT ++
Sbjct:  354 SKLKEGEHVLLNIGSTTTGSVIGRINETSGEFDLVKPACCEIGERIAISRKINNHWRLIGHGEIKDGTCIE 424          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_METJA (Translation initiation factor 2 subunit gamma OS=Methanocaldococcus jannaschii GN=eif2g PE=1 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 7.935e-11
Identity = 28/67 (41.79%), Postives = 45/67 (67.16%), Query Frame = 1
Query:   64 KVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQ 264
            K+  L   E+LMLNIG+ +T   + + + D+A ++L  P+C   G+++A+SRRV   WRLIG+G I+
Sbjct:  344 KIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIE 410          
The following BLAST results are available for this feature:
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
IF2G_DROME8.576e-2665.79Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_SCHPO4.468e-2466.22Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_RABIT3.221e-1259.32Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_META36.075e-1140.28Translation initiation factor 2 subunit gamma OS=M... [more]
IF2G_ENCCU6.075e-1142.25Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_METJA7.935e-1141.79Translation initiation factor 2 subunit gamma OS=M... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00208 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00208 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623117 ID=BQ623117|Name=BQ623117|organism=Citrus sinensis|type=EST|length=522bp
TGAACTTCTTTCTATTGCGCCGGCTTTTGGGTGTGAGGACAAAGGGCCTC
AGAAAGGCAGGGAAAGGTCTCCAAACTTGCCAAACAAGAGATTCTTATGC
TGAACATAGGATCTATGTCGACCGGAGCTAGAGTTCTTGCTGTAAAGAAT
GATTTGGCAAAACTCCAACTTACATCTCCAGTGTGCACCAGTAGGGGGGA
GAAGATTGCGCTCAGTCGAAGAGTTGAGAAGCACTGGCGTCTTATTGGCT
GGGGCCAGATTCAAGCCGGAACTACCCTCGACGTCCCTGCCAGCCACCCA
TTACAGTAAATCGGATAAATCAGAAGCAGCAAGGAGAAACAAGTAAAACA
GGGAGAGTAGTAGCAGGGAGATGTGGGAAGGTAGGGAATTGTTGGGAACA
ATTTTTGTTAGATGGAGAAGAAAACATTGTTTGGATGATTCTATTTTGCC
TCTTTTTCCTTTTTCTTGGAAATGCCTTGAATTGATTGGAAATTTTTGTT
TGGCAGTCTCATCTATTCATGA
back to top