CB304455

Overview
NameCB304455
Unique NameCB304455
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length535
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_SYNP2 (Tryptophan synthase alpha chain OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=trpA PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.585e-17
Identity = 45/89 (50.56%), Postives = 62/89 (69.66%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTGAR S++  V  LL ++++ T KP+ VGFG+S P   +Q+  WGADGVIVGSA+VK L    +P EGL  +++F +SLK A+
Sbjct:  176 VSVTGVTGARTSVASRVGELLPKLRQVTDKPIGVGFGVSDPAQARQLKEWGADGVIVGSAVVKRLATG-TPAEGLAAVKEFCESLKEAI 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PROMT (Tryptophan synthase alpha chain OS=Prochlorococcus marinus (strain NATL2A) GN=trpA PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.752e-16
Identity = 43/88 (48.86%), Postives = 64/88 (72.73%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG R+S+  +V +L++++K+S++ P+AVGFGIS  +H++QV  WGADG IVGSA+VK +  A S E  ++E   F K L++A
Sbjct:  178 VSVTGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVKRIANA-SIEMKVEEAGSFCKELRAA 264          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PROM1 (Tryptophan synthase alpha chain OS=Prochlorococcus marinus (strain NATL1A) GN=trpA PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.752e-16
Identity = 43/88 (48.86%), Postives = 64/88 (72.73%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG R+S+  +V +L++++K+S++ P+AVGFGIS  +H++QV  WGADG IVGSA+VK +  A S E  ++E   F K L++A
Sbjct:  178 VSVTGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVKRIANA-SIEMKVEEAGSFCKELRAA 264          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_ANAVT (Tryptophan synthase alpha chain OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=trpA PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.288e-16
Identity = 43/89 (48.31%), Postives = 59/89 (66.29%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG R+ + G V  LL+++++ T KP+ VGFGIS+P    QV  WGAD  IVGSA V+ L    +P EGL  + +F +SLK+A+
Sbjct:  176 VSVTGVTGMRSQVEGRVLDLLQKVRQVTDKPLGVGFGISQPAQATQVRDWGADAAIVGSAFVQRLATG-TPAEGLSAIAEFCQSLKAAI 263          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PROMP (Tryptophan synthase alpha chain OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpA PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.530e-15
Identity = 40/88 (45.45%), Postives = 59/88 (67.05%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG R  +   V+ L+ +++E +  PVAVGFGIS PEHV +V  WGADGVI+GSA VK +  + + +E + ++ KF + ++ A
Sbjct:  190 VSVTGVTGERNKMENRVENLITKLQEISINPVAVGFGISSPEHVNKVRKWGADGVIIGSAFVKRISNS-NEKEVVNQIGKFCEEMRKA 276          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PROMM (Tryptophan synthase alpha chain OS=Prochlorococcus marinus (strain MIT 9313) GN=trpA PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.316e-15
Identity = 44/88 (50.00%), Postives = 60/88 (68.18%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG R+ +   VQ+L++++K S + PVAVGFGIS P+ V+QV  WGADG IVGSA+VK +  A +P    +E   F K L++A
Sbjct:  187 VSVTGVTGERSVMEDRVQSLVQQLKLSGSNPVAVGFGISGPQQVRQVRSWGADGAIVGSALVKRMA-AAAPGLVAQEAGLFCKELRNA 273          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PORPU (Tryptophan synthase alpha chain OS=Porphyra purpurea GN=trpA PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 7.362e-15
Identity = 36/89 (40.45%), Postives = 60/89 (67.42%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS+ GVTG +  ++G ++ L   IK+ T KP+ +GFGIS  E ++++ GW  +G+++GSA VK L  +  PEEGL++++ F  + KS +
Sbjct:  184 VSTTGVTGQKPELTGKLKRLTETIKKMTQKPIILGFGISTAEQIKEIKGWNINGIVIGSAFVKRL-SSDFPEEGLRKIKDFCTTAKSII 271          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_PROMA (Tryptophan synthase alpha chain OS=Prochlorococcus marinus GN=trpA PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.615e-15
Identity = 42/88 (47.73%), Postives = 57/88 (64.77%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG R+++   VQ L+ E++  ++ PVAVGFGIS  +HV QV  WGADG I+GSA+VK +  A + +E  +E  KF   L  A
Sbjct:  178 VSVTGVTGERSALENRVQLLINELRGFSSTPVAVGFGISDTKHVIQVKRWGADGAIIGSALVKRISNATTGQEA-EEAGKFCSELYKA 264          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_SYNPX (Tryptophan synthase alpha chain OS=Synechococcus sp. (strain WH8102) GN=trpA PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.256e-14
Identity = 45/91 (49.45%), Postives = 59/91 (64.84%), Query Frame = -1
Query:  272 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLL---GEAQSPEEGLKELEKFAKSLKSA 535
            VS  GVTG RA +   V+ L+ E+K+S+  PVAVGFGIS  + V+QV  WGADG IVGSA+VK +   GE Q  EE      +F + L++A
Sbjct:  181 VSVTGVTGERAQMETRVEGLVEELKQSSAVPVAVGFGISGADQVRQVRSWGADGAIVGSALVKRMAAAGEGQIAEEA----GQFCRELRNA 267          
BLAST of CB304455 vs. ExPASy Swiss-Prot
Match: TRPA_SYNP6 (Tryptophan synthase alpha chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpA PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.139e-14
Identity = 41/89 (46.07%), Postives = 54/89 (60.67%), Query Frame = -1
Query:  269 VSSIGVTGARASISGHVQTLLREIKESTTKPVAVGFGISKPEHVQQVAGWGADGVIVGSAMVKLLGEAQSPEEGLKELEKFAKSLKSAL 535
            VS  GVTG R  +   V  LL+EI++ T KP+ VGFGIS  E  +QV  WGADGVIVGSA V  L      E+G++ +    + L+ A+
Sbjct:  176 VSVTGVTGMRQGMQSRVADLLQEIRQGTDKPIGVGFGISGAEQARQVRDWGADGVIVGSAFVNRL-----QEQGVEGVATLCRELRQAI 259          
The following BLAST results are available for this feature:
BLAST of CB304455 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
TRPA_SYNP21.585e-1750.56Tryptophan synthase alpha chain OS=Synechococcus s... [more]
TRPA_PROMT1.752e-1648.86Tryptophan synthase alpha chain OS=Prochlorococcus... [more]
TRPA_PROM11.752e-1648.86Tryptophan synthase alpha chain OS=Prochlorococcus... [more]
TRPA_ANAVT2.288e-1648.31Tryptophan synthase alpha chain OS=Anabaena variab... [more]
TRPA_PROMP2.530e-1545.45Tryptophan synthase alpha chain OS=Prochlorococcus... [more]
TRPA_PROMM4.316e-1550.00Tryptophan synthase alpha chain OS=Prochlorococcus... [more]
TRPA_PORPU7.362e-1540.45Tryptophan synthase alpha chain OS=Porphyra purpur... [more]
TRPA_PROMA9.615e-1547.73Tryptophan synthase alpha chain OS=Prochlorococcus... [more]
TRPA_SYNPX1.256e-1449.45Tryptophan synthase alpha chain OS=Synechococcus s... [more]
TRPA_SYNP68.139e-1446.07Tryptophan synthase alpha chain OS=Synechococcus s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_B01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_B01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304455 ID=CB304455|Name=CB304455|organism=Citrus sinensis|type=EST|length=535bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCACCAAGTTTTGCCATTAT
TTGAATATAGAATCCATCTTGCAAGGACTTGCAGAGTAAGCATTACACAA
TCTCCAAATCAGGATTTGGAGAATAGATTCTCTAATTTTATACTACATAT
TCAACTTTAGCATCAGGAAATACAGTTCTTTTTAAAATTTGATTCTCTAA
ATAGAAAATTGTTTTTAGAAGTACACTTGATCAAACATTATTGCTGATCT
ACATTACTGTTCTCACGGGAGAGCAGATTTTAACGATTTTGCGAATTTTT
CTAGCTCCTTCAGTCCCTCCTCAGGAGATTGTGCTTCACCCAATAGCTTC
ACCATAGCACTCCCAACAATCACACCATCAGCTCCCCATCCTGCTACTTG
TTGCACATGCTCAGGTTTTGATATGCCAAAGCCAACTGCAACGGGCTTAG
TTGTTGACTCTTTAATTTCCCTTAAAAGAGTTTGAACATGGCCACTAATA
GAAGCGCGAGCTCCAGTAACTCCAATTGAGCTTAC
back to top