CF831926
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_CALS8 (ATP synthase gamma chain OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=atpG PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.604e-11 Identity = 38/103 (36.89%), Postives = 58/103 (56.31%), Query Frame = -1 Query: 234 KMIVARDSVTFNKGELSP--LMLFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEAL 536 K ++ D F GE + +E P +LD ++ Y+ I A +S+ SE+AARM+ M T +ADE+ + L + N+ERQ IT E+ EI++GA AL Sbjct: 189 KKLLPLDPSEFVSGEFKKDETIRYEPSPTNVLDVVIYEYLKGIIFGAMMDSYVSELAARMTAMDNATKSADEMIQKLVLKLNRERQAVITQEISEIISGAAAL 291
BLAST of CF831926 vs. ExPASy Swiss-Prot
Match: ATPG_BUCMH (ATP synthase gamma chain OS=Buchnera aphidicola subsp. Melaphis rhois GN=atpG PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.604e-11 Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = -1 Query: 231 LFEQDPAQILDAMMPLYMNSQILRAFQESFASEVAARMSPMSIVTDNADELKKNLSVAYNQERQGKITGELLEIVAGAEALT 476 ++E D +L+ ++ Y+ QI +A E++ SE AARM M TDN+ +L + L + YN+ RQ IT EL EIV+GA A++ Sbjct: 206 IYESDSKLLLNKLLNNYLEFQIYQASLENYTSEQAARMIAMKQATDNSKDLIRELQIIYNKARQDNITQELTEIVSGAAAIS 287 The following BLAST results are available for this feature:
BLAST of CF831926 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 412
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF831926 ID=CF831926; Name=CF831926; organism=Citrus sinensis; type=EST; length=569bpback to top |