CF832019

Overview
NameCF832019
Unique NameCF832019
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length705
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4194 contig Csv1_Contig4194:35..738. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_SPOFR (40S ribosomal protein S17 OS=Spodoptera frugiperda GN=RpS17 PE=2 SV=3)

HSP 1 Score: 154.836 bits (390), Expect = 4.090e-37
Identity = 76/122 (62.30%), Postives = 100/122 (81.97%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALGMSDISGLVEVEP 435
            MGRVRTKTVKK+++ +IE+YY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM R+    VRGIS+KLQEEERERR ++VP+ SA++ D I+VD +T DML  L  ++I+GL   +P
Sbjct:    1 MGRVRTKTVKKAAKIIIEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQP 122          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_DROME (40S ribosomal protein S17 OS=Drosophila melanogaster GN=RpS17 PE=2 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 1.554e-36
Identity = 76/124 (61.29%), Postives = 98/124 (79.03%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALGMSDISGLVEVEPQS 441
            MGRVRTKTVKK+++ +IE+YY+R+TLDFHTNK+I EEVAIIP+K LRNKIAG+ THLM R+    VRGIS+KLQEEERERR ++VP  SA++ D I+VD +T +ML  L   +I GL   +P +
Sbjct:    1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQVRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNIRGLQLTQPNT 124          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_ANOGA (40S ribosomal protein S17 OS=Anopheles gambiae GN=RpS17 PE=2 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 7.713e-36
Identity = 74/114 (64.91%), Postives = 95/114 (83.33%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALGMSDI 411
            MGRVRTKT+KK+S+ +IE+YY+R+T+DF TNK+I+EEVAIIP+K LRNKIAGF THLM R+    VRGIS+KLQEEERERR ++VPD SA++ D I+VD ET +ML  L  ++I
Sbjct:    1 MGRVRTKTIKKASKVIIEKYYTRLTMDFDTNKRIVEEVAIIPTKPLRNKIAGFVTHLMKRLRHSQVRGISIKLQEEERERRDNYVPDVSALEQDIIEVDPETKEMLKHLDFNNI 114          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_NEUCR (40S ribosomal protein S17 OS=Neurospora crassa GN=rps-17 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.828e-35
Identity = 78/134 (58.21%), Postives = 99/134 (73.88%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAI------KTDEIKVDKETLDMLAALGMSDISGLVEVEPQSMITP 453
            MGRVRTKTVKKS++ +IERYY ++TLDF TNK+I +E+AII SKRLRNKIAG++THLM RI +GPVRGIS KLQEEERER+  +VP+ SA+      ++ ++ VD ET D+L  LG   I   V V P +   P
Sbjct:    1 MGRVRTKTVKKSAKVIIERYYPKLTLDFETNKRICDEIAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEEERERKDQYVPEVSALDFTQNSESGQLDVDTETKDLLKHLGFDSIP--VNVIPVTQAQP 132          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_DICDI (40S ribosomal protein S17 OS=Dictyostelium discoideum GN=rps17 PE=3 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 4.232e-34
Identity = 69/106 (65.09%), Postives = 90/106 (84.91%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDML 387
            MGRVRTKT+K++S+ +IE++Y R+T DF TNK+  +++A IPSKRLRNKIAGF THLM RI  GPVRGIS KLQEEERE+R ++VP ESAIKT+E+K+D++  +ML
Sbjct:    1 MGRVRTKTIKRASKLLIEKHYPRLTNDFDTNKRTCDKLAKIPSKRLRNKIAGFCTHLMRRIANGPVRGISYKLQEEEREKRDNYVPQESAIKTNEVKIDRDVEEML 106          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_CAEEL (40S ribosomal protein S17 OS=Caenorhabditis elegans GN=rps-17 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 9.428e-34
Identity = 73/115 (63.48%), Postives = 91/115 (79.13%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDE---IKVDKETLDMLAALGMS 405
            M RVRTKTVKK+SR +IE+YY+RMT DFH NK++ +EVAII SK LRNKIAG+ THLM RI +GPVRGIS+KLQEEERERR +++P+ S +   +   IKVD +T DML A G +
Sbjct:    1 MSRVRTKTVKKASRVLIEKYYTRMTNDFHNNKRVCDEVAIIGSKPLRNKIAGYITHLMRRIERGPVRGISIKLQEEERERRDNYMPEISTVDPSQLTSIKVDTDTSDMLKAAGFN 115          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17B_YEAST (40S ribosomal protein S17-B OS=Saccharomyces cerevisiae GN=RPS17B PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.231e-33
Identity = 71/127 (55.91%), Postives = 95/127 (74.80%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDE----IKVDKETLDMLAALGMSDISGLVEVEPQ 438
            MGRVRTKTVK++S+ +IERYY ++TLDF TNK++ +E+A I SKRLRNKIAG++THLM RI KGPVRGIS KLQEEERER+  +VP+ SA+        + VD +T D++ +LG+     ++ V  Q
Sbjct:    1 MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSLGLKLPLSVINVSAQ 127          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17A_YEAST (40S ribosomal protein S17-A OS=Saccharomyces cerevisiae GN=RPS17A PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.231e-33
Identity = 71/127 (55.91%), Postives = 95/127 (74.80%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDE----IKVDKETLDMLAALGMSDISGLVEVEPQ 438
            MGRVRTKTVK++S+ +IERYY ++TLDF TNK++ +E+A I SKRLRNKIAG++THLM RI KGPVRGIS KLQEEERER+  +VP+ SA+        + VD +T D++ +LG+     ++ V  Q
Sbjct:    1 MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSLGLKLPLSVINVSAQ 127          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17_ENCCU (40S ribosomal protein S17 OS=Encephalitozoon cuniculi GN=RPS17 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.493e-18
Identity = 43/110 (39.09%), Postives = 72/110 (65.45%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRIHKGPVRGISLKLQEEERERRMDFVPDESAIKTDEIKVDKETLDMLAALG 399
            MG VR K VK+++R + E+Y+ R+   F  N  ++++VA++ SK+L+N+IAG+ T L  +I KG    + +K  EEERER+ + +P ES +  D ++VD  T++M+   G
Sbjct:    1 MGCVRNKIVKRAARTIAEKYFQRLDSTFDHNLLVVQDVAVVQSKKLKNEIAGYLTSLYKKILKGTYNKVYIKSHEEERERKENVIPKESMLDVDCVEVDDVTMEMIKRYG 110          
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17E_METJA (30S ribosomal protein S17e OS=Methanocaldococcus jannaschii GN=rps17e PE=3 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 3.855e-11
Identity = 30/61 (49.18%), Postives = 46/61 (75.41%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRI 252
            MGR+R   +K+++ ++I++Y    T DF TNK++LEEVA I +KRLRN+IAG+ TH M ++
Sbjct:    1 MGRIRQTLIKRTAMELIKKYRDLFTTDFETNKRVLEEVAQISTKRLRNRIAGYITHKMRQL 61          
The following BLAST results are available for this feature:
BLAST of CF832019 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RS17_SPOFR4.090e-3762.3040S ribosomal protein S17 OS=Spodoptera frugiperda... [more]
RS17_DROME1.554e-3661.2940S ribosomal protein S17 OS=Drosophila melanogast... [more]
RS17_ANOGA7.713e-3664.9140S ribosomal protein S17 OS=Anopheles gambiae GN=... [more]
RS17_NEUCR3.828e-3558.2140S ribosomal protein S17 OS=Neurospora crassa GN=... [more]
RS17_DICDI4.232e-3465.0940S ribosomal protein S17 OS=Dictyostelium discoid... [more]
RS17_CAEEL9.428e-3463.4840S ribosomal protein S17 OS=Caenorhabditis elegan... [more]
RS17B_YEAST1.231e-3355.9140S ribosomal protein S17-B OS=Saccharomyces cerev... [more]
RS17A_YEAST1.231e-3355.9140S ribosomal protein S17-A OS=Saccharomyces cerev... [more]
RS17_ENCCU2.493e-1839.0940S ribosomal protein S17 OS=Encephalitozoon cunic... [more]
RS17E_METJA3.855e-1149.1830S ribosomal protein S17e OS=Methanocaldococcus j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C22_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832019 ID=CF832019|Name=CF832019|organism=Citrus sinensis|type=EST|length=705bp
CGACATCTCACCCTTTTAATGCTTCCCGTCTTTGTCTTCTTCAAGACAGC
AGCCCTTTCTTAAACTGAAATGGGTCGTGTTCGTACCAAGACCGTGAAGA
AGTCCTCTCGCCAGGTGATTGAGAGGTACTACTCAAGAATGACACTGGAC
TTCCATACCAACAAGAAAATTTTGGAGGAGGTTGCTATCATCCCCTCGAA
GAGGCTGCGTAACAAAATTGCTGGGTTCTCAACCCATTTGATGAATAGGA
TTCACAAGGGTCCAGTTCGTGGAATCTCCCTTAAATTGCAGGAAGAGGAG
CGCGAACGCCGCATGGACTTTGTGCCTGATGAGTCAGCTATTAAGACTGA
TGAAATTAAGGTTGACAAGGAAACCTTGGATATGCTTGCTGCTCTTGGCA
TGTCCGACATTTCTGGGCTTGTTGAAGTTGAGCCACAGAGCATGATTACT
CCTCCAGTTTTTGGTCGGGGTGGTGGCAGGAGGTACTGAGTTAATTGAGG
CTTTGTGGCTCAATCAAGAATGAGAAGTTTAGGTTCTTATTAATCAGCAC
TTCTTGTGTTTGTTATGAATGCTTTTGTGACTAGTTTTCTTTACTATTTT
AAGAAGGGTGTTTAGTTAAAACTTGAACTCTGGCATCATACTTTAGTTGA
TTTAATGGACTTGTTTTGTCTTTTCATTTTATTTGTTTAACAAAAAAAAA
AAAAA
back to top