CF832019

Overview
NameCF832019
Unique NameCF832019
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length705
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4194 contig Csv1_Contig4194:35..738. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832019 vs. ExPASy Swiss-Prot
Match: RS17E_META3 (30S ribosomal protein S17e OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps17e PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.034e-11
Identity = 28/61 (45.90%), Postives = 45/61 (73.77%), Query Frame = 1
Query:   70 MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMNRI 252
            MGR+R   +K++   ++E+Y  R+T DF TNKK+++EVA I +KRLRN++AG+ T  M ++
Sbjct:    1 MGRIRQTFIKRAGEDLVEKYEDRLTTDFETNKKVIDEVAEIATKRLRNRVAGYVTKKMKKV 61          
The following BLAST results are available for this feature:
BLAST of CF832019 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RS17E_META35.034e-1145.9030S ribosomal protein S17e OS=Methanococcus aeolic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01C22_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01C22, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832019 ID=CF832019|Name=CF832019|organism=Citrus sinensis|type=EST|length=705bp
CGACATCTCACCCTTTTAATGCTTCCCGTCTTTGTCTTCTTCAAGACAGC
AGCCCTTTCTTAAACTGAAATGGGTCGTGTTCGTACCAAGACCGTGAAGA
AGTCCTCTCGCCAGGTGATTGAGAGGTACTACTCAAGAATGACACTGGAC
TTCCATACCAACAAGAAAATTTTGGAGGAGGTTGCTATCATCCCCTCGAA
GAGGCTGCGTAACAAAATTGCTGGGTTCTCAACCCATTTGATGAATAGGA
TTCACAAGGGTCCAGTTCGTGGAATCTCCCTTAAATTGCAGGAAGAGGAG
CGCGAACGCCGCATGGACTTTGTGCCTGATGAGTCAGCTATTAAGACTGA
TGAAATTAAGGTTGACAAGGAAACCTTGGATATGCTTGCTGCTCTTGGCA
TGTCCGACATTTCTGGGCTTGTTGAAGTTGAGCCACAGAGCATGATTACT
CCTCCAGTTTTTGGTCGGGGTGGTGGCAGGAGGTACTGAGTTAATTGAGG
CTTTGTGGCTCAATCAAGAATGAGAAGTTTAGGTTCTTATTAATCAGCAC
TTCTTGTGTTTGTTATGAATGCTTTTGTGACTAGTTTTCTTTACTATTTT
AAGAAGGGTGTTTAGTTAAAACTTGAACTCTGGCATCATACTTTAGTTGA
TTTAATGGACTTGTTTTGTCTTTTCATTTTATTTGTTTAACAAAAAAAAA
AAAAA
back to top