CF832024

Overview
NameCF832024
Unique NameCF832024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length848
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1001 contig Csv1_Contig1001:731..1578. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CRIGR (Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=3 SV=3)

HSP 1 Score: 234.958 bits (598), Expect = 4.178e-61
Identity = 111/168 (66.07%), Postives = 135/168 (80.36%), Query Frame = -1
Query:  345 ALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 848
            AL EENMRG+ F+V DV LHADAIHR GGQ+IPTARR +YAS LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  691 ALCEENMRGVRFDVHDVTLHADAIHRRGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRGSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CHICK (Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3)

HSP 1 Score: 234.572 bits (597), Expect = 5.457e-61
Identity = 110/167 (65.87%), Postives = 134/167 (80.24%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YA  LTA+PRL+EP+Y+VEIQ PEQ +GGIY VLN+KRGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP +  ++ +Q+VA+ RKRKGLKE +  L  F DKL
Sbjct:  692 LCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYACVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDSASRPSQVVAETRKRKGLKEGIPALDNFLDKL 858          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_SCHPO (Elongation factor 2 OS=Schizosaccharomyces pombe GN=eft1 PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 1.216e-60
Identity = 112/165 (67.88%), Postives = 132/165 (80.00%), Query Frame = -1
Query:  345 EENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 839
            EEN+R   F + DVVLHADAIHRGGGQ+IPTARRV+YAS L A P + EPV++VEIQ  E A+GGIYSVLN+KRGHVF E QR GTPLYNIKAYLPV ESFGF+G LR AT+GQAFPQ VFDHW  MS DPL+P ++  Q+V + RKRKGLKE +   +E+ D+L
Sbjct:  678 EENLRSCRFNILDVVLHADAIHRGGGQIIPTARRVVYASTLLASPIIQEPVFLVEIQVSENAMGGIYSVLNKKRGHVFSEEQRVGTPLYNIKAYLPVNESFGFTGELRQATAGQAFPQLVFDHWSPMSGDPLDPTSKPGQIVCEARKRKGLKENVPDYTEYYDRL 842          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_DROME (Elongation factor 2 OS=Drosophila melanogaster GN=Ef2b PE=1 SV=4)

HSP 1 Score: 230.335 bits (586), Expect = 1.029e-59
Identity = 107/167 (64.07%), Postives = 133/167 (79.64%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            LA+EN+RG+ F + DV LHADAIHRGGGQ+IPT RR +YA+ +TAKPRL+EPVY+ EIQ PE A+GGIY VLN++RGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP EP ++   +V D RKRKGLKE +  LS++ DKL
Sbjct:  678 LADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAITAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQYLDKL 844          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_BOMMO (Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.324e-58
Identity = 104/167 (62.28%), Postives = 131/167 (78.44%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            +AEEN+RG+ F + DV LH DAIHRGGGQ+IPT RR +YA  LTA+PRL+EPVY+ EIQ PE A+GGIY VLN++RGHVFEE Q  GTP++ +KAYLPV ESFGF+  LR+ T GQAFPQCVFDHW ++  DP EP ++   +V + RKRKGLKE +  L+++ DKL
Sbjct:  678 MAEENLRGVRFNIYDVTLHTDAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFIVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPCEPQSKPYNVVQETRKRKGLKEGLPDLTQYLDKL 844          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_NEUCR (Elongation factor 2 OS=Neurospora crassa GN=cot-3 PE=3 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 7.375e-58
Identity = 107/168 (63.69%), Postives = 133/168 (79.17%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMM-SSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            + EE MR I F + DV LHADAIHRGGGQ+IPTARRV+YA+ L A+P LLEPV++VEIQ PEQA+GG+Y VL ++RGHVF E QRPGTPL+ IKAYLPV+ESFGF+G LRAATSGQAFPQ VFDHW+ +    PL+  ++  Q+V ++RKRKGLK ++     + DKL
Sbjct:  677 IGEEPMRSIRFNILDVTLHADAIHRGGGQIIPTARRVLYAATLLAEPSLLEPVFLVEIQVPEQAMGGVYGVLTRRRGHVFGEEQRPGTPLFTIKAYLPVMESFGFNGDLRAATSGQAFPQSVFDHWERLPGGSPLDSTSKVGQIVQEMRKRKGLKVEVPGYENYYDKL 844          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_CRYPV (Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.817e-56
Identity = 102/167 (61.08%), Postives = 131/167 (78.44%), Query Frame = -1
Query:  345 LAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 845
            L EE+MRGI F + DV LHADAIHRG GQ+ PT RRV+YA+ LTA PRLLEP+++VEI AP++ +GGIY+ LNQ+RGHVF E  + GTP   IKAYLPV +SF F+  LRAATSG+AFPQCVFDHW++++ DPLE G++  +LV  IR+RK +KE++  L  + DKL
Sbjct:  666 LCEEDMRGIRFNLLDVTLHADAIHRGAGQITPTCRRVMYAAALTASPRLLEPMFLVEISAPQEVVGGIYATLNQRRGHVFHEEPKSGTPQVEIKAYLPVADSFKFTTVLRAATSGKAFPQCVFDHWELINGDPLEKGSKTEELVKAIRRRKNIKEEIPALDNYLDKL 832          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_KLULA (Elongation factor 2 OS=Kluyveromyces lactis GN=EFT1 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 9.015e-56
Identity = 101/164 (61.59%), Postives = 126/164 (76.83%), Query Frame = -1
Query:  345 ENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 836
            E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A+P++ EPV++VEIQ PEQA+GGIYSVLN+KRG V  E QRPGTPL+ +KAYLP+ ESFGF+G LR AT GQAFPQ VFDHW  + +DPL+P T+A ++V   RKR+G+KE++    E+ DKL
Sbjct:  679 EQMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAIGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPINESFGFTGELRQATGGQAFPQMVFDHWATLGTDPLDPSTKAGEIVLAARKRQGMKEEVPGWQEYYDKL 842          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_SACKL (Elongation factor 2 OS=Saccharomyces kluyveri GN=EFT2 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.008e-55
Identity = 102/164 (62.20%), Postives = 125/164 (76.22%), Query Frame = -1
Query:  345 ENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 836
            E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A+P++ EPV++VEIQ PEQA+GGIYSVLN+KRG V  E QRPGTPL+ +KAYLPV ESFGF+G LR AT GQAFPQ VFDHW  + +DPL+P T+A ++V   RKR G+KE++    E+ DKL
Sbjct:  679 EQMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAVGGIYSVLNRKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWATLGTDPLDPTTKAGEIVTAARKRHGMKEEVPGWQEYYDKL 842          
BLAST of CF832024 vs. ExPASy Swiss-Prot
Match: EF2_YEAST (Elongation factor 2 OS=Saccharomyces cerevisiae GN=EFT1 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.426e-55
Identity = 102/164 (62.20%), Postives = 124/164 (75.61%), Query Frame = -1
Query:  345 ENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYMVEIQAPEQALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVIESFGFSGTLRAATSGQAFPQCVFDHWDMMSSDPLEPGTQAAQLVADIRKRKGLKEQMTPLSEFEDKL 836
            E MR +   + DV LHADAIHRGGGQ+IPT RR  YA  L A P++ EPV++VEIQ PEQA+GGIYSVLN+KRG V  E QRPGTPL+ +KAYLPV ESFGF+G LR AT GQAFPQ VFDHW  + SDPL+P ++A ++V   RKR G+KE++    E+ DKL
Sbjct:  679 EEMRSVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLADPKIQEPVFLVEIQCPEQAVGGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEEVPGWQEYYDKL 842          
The following BLAST results are available for this feature:
BLAST of CF832024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 100
Match NameE-valueIdentityDescription
EF2_CRIGR4.178e-6166.07Elongation factor 2 OS=Cricetulus griseus GN=EEF2 ... [more]
EF2_CHICK5.457e-6165.87Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 ... [more]
EF2_SCHPO1.216e-6067.88Elongation factor 2 OS=Schizosaccharomyces pombe G... [more]
EF2_DROME1.029e-5964.07Elongation factor 2 OS=Drosophila melanogaster GN=... [more]
EF2_BOMMO4.324e-5862.28Translation elongation factor 2 OS=Bombyx mori GN=... [more]
EF2_NEUCR7.375e-5863.69Elongation factor 2 OS=Neurospora crassa GN=cot-3 ... [more]
EF2_CRYPV1.817e-5661.08Elongation factor 2 OS=Cryptosporidium parvum PE=3... [more]
EF2_KLULA9.015e-5661.59Elongation factor 2 OS=Kluyveromyces lactis GN=EFT... [more]
EF2_SACKL2.008e-5562.20Elongation factor 2 OS=Saccharomyces kluyveri GN=E... [more]
EF2_YEAST3.426e-5562.20Elongation factor 2 OS=Saccharomyces cerevisiae GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D01_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832024 ID=CF832024|Name=CF832024|organism=Citrus sinensis|type=EST|length=848bp
TAATAATATATCAACCAACGTCGGCCAGAATTAGTCCTTCACATGACAGA
ACATCAAACCTTAAAAGCTGTGAATTGTAAAATTTAAAACCTAGATGACA
GAGACAGGGTTACTAAACCCAATCAACAGTAATATTACTTTACTAAACAC
AATGAGGATATTGAAAAACTTTGAAACAAAAATAAGCATCAGCAAAAAAT
ATTGCTGCGCAATCTCACCCTTGATGTCAAGATGAAATGTTTACAGCTCG
TCCTCTACTCGGATAGCGGTGTCATTTGCTCCCTCTTCCTGATATCAGCA
ACAAGCTGCGCAATCTCACCCTTGATGTCAAGACGAAATGTTTACAGCTT
GTCCTCAAACTCAGATAGTGGTGTCATTTGCTCCTTCAAGCCCTTCCTCT
TCCTGATATCAGCAACAAGCTGTGCAGCCTGTGTACCAGGCTCCAGTGGA
TCGGATGACATCATGTCCCAGTGATCAAACACACATTGTGGGAAGGCCTG
TCCTGACGTTGCAGCCCTCAAAGTGCCTGAGAATCCAAAGGACTCGATGA
CGGGAAGGTAAGCCTTGATGTTGTAAAGGGGGGTACCAGGTCTCTGCATT
TCCTCGAACACGTGACCACGTTTCTGATTGAGAACACTGTAAATACCACC
AAGGGCCTGCTCGGGAGCCTGTATTTCGACCATGTAGACAGGCTCAAGAA
GCCTGGGCTTGGCTGTGAGCTGGGAAGCATATATGACCCTCCTAGCAGTA
GGAATGACTTGACCACCACCTCTGTGAATGGCATCAGCATGAAGAACAAC
ATCACATACTTCAAAGCAGATACCTCTCATGTTCTCTTCAGCCAGCGC
back to top