CF832028

Overview
NameCF832028
Unique NameCF832028
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1002 contig Csv1_Contig1002:1..769. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_NEUCR (60S ribosomal protein L7 OS=Neurospora crassa GN=rpl-7 PE=3 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 1.514e-59
Identity = 111/169 (65.68%), Postives = 137/169 (81.07%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR-NHYVEGGDAGNREDYINELIRRMN 769
            F++  EAKL+F+IRI+GIN + PK +KILQLLRL QI NGVF++V KAT  M+  VEP+V YGYPNLKSVKELIYKRGYGK+NKQR+ALTDN IIE+ LG++GIICMED IHEI TVGP+FK+A+NFLWPF           ++  H++EGGD GNRE++IN LIR+MN
Sbjct:   80 FHIPAEAKLIFLIRIKGINKIPPKPRKILQLLRLLQINNGVFVRVTKATAEMIKIVEPWVAYGYPNLKSVKELIYKRGYGKVNKQRVALTDNSIIEENLGKYGIICMEDLIHEIYTVGPNFKQASNFLWPFKLSNPTGGFRTRKFKHFIEGGDLGNREEHINALIRQMN 248          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_DROME (60S ribosomal protein L7 OS=Drosophila melanogaster GN=RpL7 PE=2 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 2.418e-57
Identity = 108/168 (64.29%), Postives = 130/168 (77.38%), Query Frame = -1
Query:  269 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQ-HGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRM 769
            FYV  EAKL F++RIRGIN V PK +K+LQL RLRQI NGVF+K+NKAT+NML   EPY+T+GYPNLKSV+ELIYKRG+ K N+QR+ +TDNF+IE+ L Q H I C+ED +HEI TVGP+FK A+NFLWPF           K NHYV GGD GNRED IN L+R+M
Sbjct:   84 FYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKM 251          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_YARLI (60S ribosomal protein L7 OS=Yarrowia lipolytica GN=RPL7 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.860e-55
Identity = 103/170 (60.59%), Postives = 130/170 (76.47%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR--NHYVEGGDAGNREDYINELIRRMN 769
            FYV  E KL+F+IRI+GI+ + PK +K+LQLLRL QI NGVF+++ KAT  +L  VEPY+ +GYPNL SV++L+YKRGYGK+NKQRI L+DN IIE+ALG++GIICMED IHEI TVGP FK+A+NFLWPF           +R   HY+EGG  GNRE+ IN LI+  N
Sbjct:   81 FYVPAEPKLVFVIRIKGISKMAPKPRKVLQLLRLHQINNGVFVRITKATAELLRIVEPYIAFGYPNLASVRQLVYKRGYGKVNKQRIPLSDNAIIEEALGKYGIICMEDLIHEIYTVGPAFKQASNFLWPFKLSNPSGGWGVRRKFKHYIEGGSTGNREENINALIKAQN 250          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7C_SCHPO (60S ribosomal protein L7-C OS=Schizosaccharomyces pombe GN=rpl7c PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 8.599e-55
Identity = 103/168 (61.31%), Postives = 132/168 (78.57%), Query Frame = -1
Query:  269 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR-NHYVEGGDAGNREDYINELIRRM 769
            +YV  E KL+F+IRIRGIN + PK +KI+QLLRL QI NGVF+K NKAT  ML  VEPYVTYG PNLK+V+EL+YKRG+GK+NKQRIAL+DN IIE ALG++ I+ +ED IHEI TVGP+FK+A NF+WPF           ++  H++EGGDAG R+++IN L+R+M
Sbjct:   83 YYVPDETKLVFVIRIRGINNIPPKARKIMQLLRLIQINNGVFVKFNKATKEMLQVVEPYVTYGIPNLKTVRELLYKRGFGKVNKQRIALSDNAIIEAALGKYSILSIEDLIHEIYTVGPNFKQAANFIWPFQLSSPLGGWRDRKFKHFIEGGDAGKRDEHINSLVRKM 250          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_CAEEL (60S ribosomal protein L7 OS=Caenorhabditis elegans GN=rpl-7 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.123e-54
Identity = 100/167 (59.88%), Postives = 126/167 (75.45%), Query Frame = -1
Query:  269 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRM 769
            FYV  E K+ F++RIRGIN + PK +K LQ+LRLRQI NGVF+K+NKATL +L  +EPYV +GYPN K++ +L+YKRGY K++  R+ +TDN I+EQ+LG+  IIC+ED  HEI TVGPHFKEA NFLWPF           K NH+VEGGD GNRED IN L+R+M
Sbjct:   77 FYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGNRVPITDNTIVEQSLGKFNIICLEDLAHEIATVGPHFKEATNFLWPFKLNNPTGGWTKKTNHFVEGGDFGNREDQINNLLRKM 243          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_DICDI (60S ribosomal protein L7 OS=Dictyostelium discoideum GN=rpl7 PE=1 SV=3)

HSP 1 Score: 210.69 bits (535), Expect = 7.279e-54
Identity = 102/168 (60.71%), Postives = 127/168 (75.60%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRNHYVEGGDAGNREDYINELIRRMN 769
            FYV P AK+ F+IRIRGIN V PK +K+L+LLRL Q+ NGVF+K+NKA++NML  VEPYV YG+PNLKS+KELIYKRG+ K++ QRI LT N ++E+ LG+ GIIC+ED IHEI T G HFK+ NN LWPF           K+  +++GGDAGNRE  IN LI RMN
Sbjct:   79 FYVPPAAKVAFVIRIRGINGVSPKPRKVLKLLRLLQLNNGVFVKLNKASINMLKLVEPYVAYGFPNLKSIKELIYKRGHLKIDGQRIPLTSNDMVEKQLGKFGIICVEDIIHEITTCGKHFKQVNNSLWPFKLNCPRGGFNMKKTPFLQGGDAGNREHLINNLIHRMN 246          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_ASHGO (60S ribosomal protein L7 OS=Ashbya gossypii GN=RPL7 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 9.507e-54
Identity = 96/170 (56.47%), Postives = 131/170 (77.06%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR--NHYVEGGDAGNREDYINELIRRMN 769
            +YV  + KL+F+IRI+GIN + PK +K+LQLLRL QI +GVF+KV KAT  +L  VEPYV YGYP+  ++++L+YKRGYGK+NKQRIAL++N I+E  LG++GII ++D IHEI+TVGPHFK+ANNFLWPF            R   H+++GG  GNRE++IN+L++ MN
Sbjct:   74 YYVESQPKLVFVIRIKGINKIAPKPRKVLQLLRLNQINSGVFVKVTKATTELLRLVEPYVAYGYPSYSTIRQLVYKRGYGKINKQRIALSENSIVEANLGKYGIISVDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGAFGNREEFINKLVKSMN 243          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7B_YEAST (60S ribosomal protein L7-B OS=Saccharomyces cerevisiae GN=RPL7B PE=1 SV=3)

HSP 1 Score: 205.682 bits (522), Expect = 2.342e-52
Identity = 91/170 (53.53%), Postives = 130/170 (76.47%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR--NHYVEGGDAGNREDYINELIRRMN 769
            +YV  + KL+F++RI+GIN + PK +K+LQLLRL +I +G F+KV KATL +L  +EPYV YGYP+  ++++L+YKRG+GK+NKQR+ L+DN IIE  LG++GI+ ++D IHEI+TVGPHFK+ANNFLWPF            R   H+++GG  GNRE++IN+L++ MN
Sbjct:   75 YYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKAMN 244          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7A_YEAST (60S ribosomal protein L7-A OS=Saccharomyces cerevisiae GN=RPL7A PE=1 SV=3)

HSP 1 Score: 205.682 bits (522), Expect = 2.342e-52
Identity = 91/170 (53.53%), Postives = 130/170 (76.47%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR--NHYVEGGDAGNREDYINELIRRMN 769
            +YV  + KL+F++RI+GIN + PK +K+LQLLRL +I +G F+KV KATL +L  +EPYV YGYP+  ++++L+YKRG+GK+NKQR+ L+DN IIE  LG++GI+ ++D IHEI+TVGPHFK+ANNFLWPF            R   H+++GG  GNRE++IN+L++ MN
Sbjct:   75 YYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKSMN 244          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_DEBHA (60S ribosomal protein L7 OS=Debaryomyces hansenii GN=RPL7 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.058e-52
Identity = 93/169 (55.03%), Postives = 131/169 (77.51%), Query Frame = -1
Query:  266 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKR-NHYVEGGDAGNREDYINELIRRMN 769
            +YV+ + KL+F++RI+GIN + PK +K+LQLLRL QI  GVF+++ KAT  +L   EPY+ YGYPNL +++ L+YKRG+GK+NKQRIAL+DN IIE  LG++GI+ +ED IHEI TVGP+FK+ANNFLWPF           ++  H+++GGD GNRE++IN L+++MN
Sbjct:   73 YYVDAQPKLVFVVRIKGINKIAPKPRKVLQLLRLTQINAGVFVRLTKATSELLKLAEPYIAYGYPNLSTIRHLVYKRGHGKINKQRIALSDNAIIEANLGKYGILSIEDLIHEIYTVGPNFKQANNFLWPFKLSNPNGGFRTRKFFHFIQGGDTGNREEFINALVKQMN 241          
The following BLAST results are available for this feature:
BLAST of CF832028 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RL7_NEUCR1.514e-5965.6860S ribosomal protein L7 OS=Neurospora crassa GN=r... [more]
RL7_DROME2.418e-5764.2960S ribosomal protein L7 OS=Drosophila melanogaste... [more]
RL7_YARLI3.860e-5560.5960S ribosomal protein L7 OS=Yarrowia lipolytica GN... [more]
RL7C_SCHPO8.599e-5561.3160S ribosomal protein L7-C OS=Schizosaccharomyces ... [more]
RL7_CAEEL1.123e-5459.8860S ribosomal protein L7 OS=Caenorhabditis elegans... [more]
RL7_DICDI7.279e-5460.7160S ribosomal protein L7 OS=Dictyostelium discoide... [more]
RL7_ASHGO9.507e-5456.4760S ribosomal protein L7 OS=Ashbya gossypii GN=RPL... [more]
RL7B_YEAST2.342e-5253.5360S ribosomal protein L7-B OS=Saccharomyces cerevi... [more]
RL7A_YEAST2.342e-5253.5360S ribosomal protein L7-A OS=Saccharomyces cerevi... [more]
RL7_DEBHA3.058e-5255.0360S ribosomal protein L7 OS=Debaryomyces hansenii ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D03_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832028 ID=CF832028|Name=CF832028|organism=Citrus sinensis|type=EST|length=769bp
TTTTTTTTTTTTTTTTTAATTAAAAACAGATCCGCCACTTCCTTAAATGA
AACTAAAACACATGAAAACAAAAAATAAAATCCTTAATGATAATCCAGTC
TGAAGCCAAAATAACAACACTGTCACTGTTATAAAAAGTAAGAAAGTTTC
TACTTAACTTCCAGGGAAAAGGCTGGGAATAATAGGAAACACTAAAAGCC
AAAATTTAAGATATTGATCACATCAAAACTTCTTCAAAAGGGGTAGGATA
TTCTGCAAAAGCCTAGTTCATCCTTCTGATGAGCTCATTGATGTAATCTT
CACGGTTTCCTGCATCACCGCCTTCAACATAGTGGTTCCTCTTCTTCTTC
AGGCCACCCAATGGTGCCTTGAGCTTGAAGGGCCATAGGAAGTTGTTTGC
CTCCTTGAAGTGAGGACCAACAGTCAAAATCTCATGGATGAAATCTTCCA
TGCAAATAATTCCATGCTGCCCAAGAGCCTGTTCGATGATAAAATTGTCG
GTCAAAGCAATCCTCTGCTTATTTAATTTGCCGTAACCCCTCTTGTAAAT
CAGTTCTTTGACACTCTTTAAATTGGGGTACCCATATGTTACATAGGGCT
CAACTCTGTGCAGCATATTGAGTGTGGCTTTGTTCACTTTCAAAAAGACA
CCATTAAAAATCTGTCTCAAACGGAGAAGCTGCAAAATTTTCTTGGTCTT
TGGATCAACAGCATTGATACCGCGAATCCTGATAATGAACAAAAGCTTAG
CTTCTGGGTTGACATAAAA
back to top