CF832028

Overview
NameCF832028
Unique NameCF832028
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1002 contig Csv1_Contig1002:1..769. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_YEAST (Ribosome biogenesis protein RLP7 OS=Saccharomyces cerevisiae GN=RLP7 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.088e-23
Identity = 62/131 (47.33%), Postives = 78/131 (59.54%), Query Frame = -1
Query:  377 LLFIIRIRGINAVDPKTK--KILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGY------GKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPF 745
            LLFI+R+RG  AV+   K  KIL LLRL +   GVF+K+ K    +L  + PYV  G P+L S++ LI KRG        +     I L DN I+E+ LG HGIIC+ED IHEI T+G  F   N FL PF
Sbjct:  141 LLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPF 271          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_CANGA (Ribosome biogenesis protein RLP7 OS=Candida glabrata GN=RLP7 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.253e-21
Identity = 56/136 (41.18%), Postives = 86/136 (63.24%), Query Frame = -1
Query:  377 NPEAKLLFIIRIRGINA--VDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRG---YGKLNKQR---IALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPF 760
            N E +LLF++R++G  A  +  K  +IL  LRL ++   VF+K+ + T ++L  + PYV  G P+LKS++ LI KR    Y + +++    I L DN I+E+ LG  G+IC++D IHEI T+G +F + N FL PF
Sbjct:  131 NGEEQLLFVLRVKGPVAASIPHKAYRILSTLRLEEVNTAVFIKLTETTFSLLKIIAPYVIVGKPSLKSIRSLIQKRSKIVYKREDEEEAKEIILNDNNIVEEKLGDCGVICIDDIIHEIATLGENFTKCNFFLQPF 266          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_KLULA (Ribosome biogenesis protein RLP7 OS=Kluyveromyces lactis GN=RLP7 PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.637e-21
Identity = 57/134 (42.54%), Postives = 79/134 (58.96%), Query Frame = -1
Query:  377 EAKLLFIIRIRGINAVD--PKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNK------QRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPF 754
            E  LLF+IR++G  AV    K  K+L LLRL ++  GVF+K+ K    +L  V PY+  G P+L S++ LI KR      +      + I L DN I+E+ LG  G+IC+ED IHEI T+G +F +   FL PF
Sbjct:  134 EPSLLFVIRVKGPTAVKIPAKAYKVLSLLRLVELNTGVFIKLTKDVYPLLKLVSPYIVIGQPSLASIRSLIQKRSRIMWQRPEDKEPKEIILNDNNIVEEKLGDEGVICIEDIIHEISTLGENFSKCTFFLLPF 267          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_ASHGO (Ribosome biogenesis protein RLP7 OS=Ashbya gossypii GN=RLP7 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.810e-20
Identity = 53/133 (39.85%), Postives = 78/133 (58.65%), Query Frame = -1
Query:  377 AKLLFIIRIRGINA--VDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGY------GKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPF 751
            A LLF++R+RG  A  +  K  ++L LLRL ++  GVF+++      +L  V PYV  G P+L S++ L+ KR        G+     + L DN ++E+ LG  G+IC+ED IHEI T+G  F + N FL PF
Sbjct:  110 ATLLFVVRVRGPAAAKIPRKAHRVLTLLRLAEVNTGVFVRLTAEVFPLLQVVAPYVVVGRPSLASIRALVQKRARVVHQRAGEAAPVEMVLNDNGVVEERLGDEGVICVEDIIHEIATMGEAFAKCNFFLLPF 242          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RL7_ENCCU (60S ribosomal protein L7 OS=Encephalitozoon cuniculi GN=RPL7 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.032e-20
Identity = 54/168 (32.14%), Postives = 95/168 (56.55%), Query Frame = -1
Query:  269 FYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLNKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPFXXXXXXXXXXXKRN-HYVEGGDAGNREDYINELIRRM 769
            FYV  EA+   +I IR      PK +K+L+L RL++I   V ++ NK+T  ML  ++ +V +G   ++ +++L+Y +G G+    R+ LT+ FI +   G+  I C+E+ +H I      FK+ N+FL+PF           +++  + +GG  GN +D ++ L+ RM
Sbjct:   73 FYVPKEAEFFAVILIRSKCNCPPKVRKVLELFRLKRINTCVLVRNNKSTRKMLQIIKDHVAFGTIGMELLRKLVYTKGSGRNGHVRVKLTNEFIEDMFDGK--IRCIEELVHHIYNGTEMFKKVNSFLYPFHLSPPRGGFKGQKSKSFNDGGSVGNHQDLLSNLLERM 238          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_DEBHA (Ribosome biogenesis protein RLP7 OS=Debaryomyces hansenii GN=RLP7 PE=3 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.297e-18
Identity = 56/136 (41.18%), Postives = 82/136 (60.29%), Query Frame = -1
Query:  377 AKLLFIIRI----RGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGY-----GKLNKQRIA-LTDNFIIEQALGQH-GIICMEDFIHEILTVGPHFKEANNFLWPF 751
            AKLLFIIRI    +G+  V  K +K+L LLRL +   GVF+K+  AT+ +L  + PY+  G P+L S+++L  KR        +  + RI  L +N ++E   G   G IC+ED IHE+ T+G HFK  +N++ PF
Sbjct:   92 AKLLFIIRIPDHTKGLK-VPSKARKVLHLLRLNRPNTGVFVKLTPATVPLLKLISPYIVAGKPSLNSIRKLFQKRACISVIDEETKEPRITKLDNNGVVEDKFGDDLGCICIEDLIHELATLGEHFKTVSNWILPF 226          
BLAST of CF832028 vs. ExPASy Swiss-Prot
Match: RLP7_PICJA (Ribosome biogenesis protein RLP7 (Fragment) OS=Pichia jadinii GN=RLP7 PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.532e-16
Identity = 49/131 (37.40%), Postives = 76/131 (58.02%), Query Frame = -1
Query:  377 LLFIIRIRG-INAVDP-KTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKL------NKQRIALTDNFIIEQALGQHGIICMEDFIHEILTVGPHFKEANNFLWPF 745
            L  I+R  G + A  P K +K+LQLLRL +I +GVF+K+ +    +L  + PY     P+L++V++L+ KR    +        +++ L DN ++E+ LG  GIIC+ED IHE   +   FK   +FL PF
Sbjct:   32 LYLIVRTPGPVGAKIPSKVQKVLQLLRLNKINSGVFVKLTETVYPLLKLLSPYTVIXQPSLQTVRQLVQKRATVTVTHANDEEPRQVKLNDNNLVEEKLGDEGIICIEDIIHETSHLATTFKTVTHFLDPF 162          
The following BLAST results are available for this feature:
BLAST of CF832028 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
RLP7_YEAST5.088e-2347.33Ribosome biogenesis protein RLP7 OS=Saccharomyces ... [more]
RLP7_CANGA1.253e-2141.18Ribosome biogenesis protein RLP7 OS=Candida glabra... [more]
RLP7_KLULA1.637e-2142.54Ribosome biogenesis protein RLP7 OS=Kluyveromyces ... [more]
RLP7_ASHGO1.810e-2039.85Ribosome biogenesis protein RLP7 OS=Ashbya gossypi... [more]
RL7_ENCCU4.032e-2032.1460S ribosomal protein L7 OS=Encephalitozoon cunicu... [more]
RLP7_DEBHA1.297e-1841.18Ribosome biogenesis protein RLP7 OS=Debaryomyces h... [more]
RLP7_PICJA3.532e-1637.40Ribosome biogenesis protein RLP7 (Fragment) OS=Pic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01D03_f Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832028 ID=CF832028|Name=CF832028|organism=Citrus sinensis|type=EST|length=769bp
TTTTTTTTTTTTTTTTTAATTAAAAACAGATCCGCCACTTCCTTAAATGA
AACTAAAACACATGAAAACAAAAAATAAAATCCTTAATGATAATCCAGTC
TGAAGCCAAAATAACAACACTGTCACTGTTATAAAAAGTAAGAAAGTTTC
TACTTAACTTCCAGGGAAAAGGCTGGGAATAATAGGAAACACTAAAAGCC
AAAATTTAAGATATTGATCACATCAAAACTTCTTCAAAAGGGGTAGGATA
TTCTGCAAAAGCCTAGTTCATCCTTCTGATGAGCTCATTGATGTAATCTT
CACGGTTTCCTGCATCACCGCCTTCAACATAGTGGTTCCTCTTCTTCTTC
AGGCCACCCAATGGTGCCTTGAGCTTGAAGGGCCATAGGAAGTTGTTTGC
CTCCTTGAAGTGAGGACCAACAGTCAAAATCTCATGGATGAAATCTTCCA
TGCAAATAATTCCATGCTGCCCAAGAGCCTGTTCGATGATAAAATTGTCG
GTCAAAGCAATCCTCTGCTTATTTAATTTGCCGTAACCCCTCTTGTAAAT
CAGTTCTTTGACACTCTTTAAATTGGGGTACCCATATGTTACATAGGGCT
CAACTCTGTGCAGCATATTGAGTGTGGCTTTGTTCACTTTCAAAAAGACA
CCATTAAAAATCTGTCTCAAACGGAGAAGCTGCAAAATTTTCTTGGTCTT
TGGATCAACAGCATTGATACCGCGAATCCTGATAATGAACAAAAGCTTAG
CTTCTGGGTTGACATAAAA
back to top