CK933906

Overview
NameCK933906
Unique NameCK933906
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length847
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4378 contig Csv1_Contig4378:26..872. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_CHICK (High mobility group protein B1 OS=Gallus gallus GN=HMGB1 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 9.438e-13
Identity = 36/76 (47.37%), Postives = 47/76 (61.84%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP S FF+F  EFR + K  +P   S+  V K  GE W ++S+ +K PY  KA K K +YEKD+ DY  +
Sbjct:   88 DPNAPKRPPSGFFLFCSEFRPKIKSTNP-GISIGDVAKKLGEMWNNLSDGEKQPYNNKAAKLKEKYEKDVADYKSK 162          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_RAT (High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_PAPAN (High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_MOUSE (High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_MACFA (High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_HUMAN (High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_HORSE (High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_CRIGR (High mobility group protein B1 (Fragment) OS=Cricetulus griseus GN=HMGB1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   56 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 130          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_CANFA (High mobility group protein B1 OS=Canis familiaris GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_CALMO (High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
The following BLAST results are available for this feature:
BLAST of CK933906 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
HMGB1_CHICK9.438e-1347.37High mobility group protein B1 OS=Gallus gallus GN... [more]
HMGB1_RAT2.103e-1247.37High mobility group protein B1 OS=Rattus norvegicu... [more]
HMGB1_PAPAN2.103e-1247.37High mobility group protein B1 OS=Papio anubis GN=... [more]
HMGB1_MOUSE2.103e-1247.37High mobility group protein B1 OS=Mus musculus GN=... [more]
HMGB1_MACFA2.103e-1247.37High mobility group protein B1 OS=Macaca fascicula... [more]
HMGB1_HUMAN2.103e-1247.37High mobility group protein B1 OS=Homo sapiens GN=... [more]
HMGB1_HORSE2.103e-1247.37High mobility group protein B1 OS=Equus caballus G... [more]
HMGB1_CRIGR2.103e-1247.37High mobility group protein B1 (Fragment) OS=Crice... [more]
HMGB1_CANFA2.103e-1247.37High mobility group protein B1 OS=Canis familiaris... [more]
HMGB1_CALMO2.103e-1247.37High mobility group protein B1 OS=Callicebus moloc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933906 ID=CK933906|Name=CK933906|organism=Citrus sinensis|type=EST|length=847bp
GGGGACACAAACAACGCATCCGCTATTCACATCTGCGTCTCTCTCTTTTT
CTCTTTCCTCTTTTTCTCTCATTTGAAGCCCTAACCCTAGCTCTATCTTT
CTTCAGAAACAGGATTTGAAATGAAAGGAGGTAAATCAAAGTCAGACACC
AGAAACGCCAAGCTCTCTGTGAACAAGAAGCCTGCCAAAGCTGGACGAAA
ATCGGGAAAGGCAGCTAAGGACCCGAACAAGCCAAAGAGGCCAGCCAGCG
CCTTCTTTGTTTTCATGGAAGAATTCCGTGAACAATACAAGAAGGATCAT
CCTAAGAACAAATCAGTTGCTGCTGTTGGTAAAGCTGGTGGTGAGAAATG
GAAGTCAATGTCTGAAGCTGATAAAGCACCGTATGTTGCTAAGGCAGAGA
AGCGCAAGGTTGAGTATGAGAAGGATATGAAAGACTACAATAGGAGACAG
GCGGAGGGAACTAAGCCGGAGGAAGAAGAGGAGTCTGAGAAGTCTATGTC
AGAGGTGAATGATGAGGATGATGATGAAGAAGGCAGTGGCGAGGAGGATG
ATGATGAATAGAAGTTGAAGGAAGAAATTAGCATAGTCATGTTAGGCTGT
GACAATGTTTCAAACAACATATGTTAATGCTTTGTGCTTCCATGTTAATT
TTTTTGGATGCTTTCATCATCTTCATCATCATGTAAGAGAATCATGTTGC
TTCTCCCTCGACATTTTCTTATGCCTGCCTTTCAAAGAATTAATAGCTGT
AGGTGGGAGATTCACTGCTCTATATGTACTGTGTTCTAAAGCTTAATGAT
TTAGCTAAGGCGTTCCATCGTTTGTAAAAAAAAAAAAAAAAAAAAAA
back to top