CK933906

Overview
NameCK933906
Unique NameCK933906
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length847
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4378 contig Csv1_Contig4378:26..872. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_CALJA (High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_BOVIN (High mobility group protein B1 OS=Bos taurus GN=HMGB1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.103e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB1_PIG (High mobility group protein B1 OS=Sus scrofa GN=HMGB1 PE=2 SV=3)

HSP 1 Score: 72.7886 bits (177), Expect = 2.746e-12
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKHPYEKKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_RAT (High mobility group protein B2 OS=Rattus norvegicus GN=Hmgb2 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.587e-12
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K +HP   S+    K  GE W   S  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEHRPKIKSEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_PIG (High mobility group protein B2 OS=Sus scrofa GN=HMGB2 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.587e-12
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K +HP   S+    K  GE W   S  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEHRPKIKSEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_HUMAN (High mobility group protein B2 OS=Homo sapiens GN=HMGB2 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 3.587e-12
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K +HP   S+    K  GE W   S  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEHRPKIKSEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_BOVIN (High mobility group protein B2 OS=Bos taurus GN=HMGB2 PE=1 SV=3)

HSP 1 Score: 72.4034 bits (176), Expect = 3.587e-12
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K +HP   S+    K  GE W   S  DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEHRPKIKSEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: HMGB2_CHICK (High mobility group protein B2 OS=Gallus gallus GN=HMGB2 PE=2 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.118e-12
Identity = 36/76 (47.37%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRR 447
            DPN PKRP SAFF+F  E R + K DHP   S+    K  GE W      DK PY  KA K K +YEKD+  Y  +
Sbjct:   91 DPNAPKRPPSAFFLFCSEHRPKIKNDHP-GLSIGDTAKKLGEMWSEQLAKDKQPYEQKAAKLKEKYEKDIAAYRAK 165          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: SSRP1_RAT (FACT complex subunit SSRP1 OS=Rattus norvegicus GN=Ssrp1 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.044e-11
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQAEGTK 465
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK MS+  K  +  KAE  + EYEK MK+Y   + + +K
Sbjct:  543 DPNAPKRPMSAYMLWLNASREKIKSDHP-GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARREYEKAMKEYEGGRGDSSK 623          
BLAST of CK933906 vs. ExPASy Swiss-Prot
Match: SSRP1_MOUSE (FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.044e-11
Identity = 35/82 (42.68%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  220 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKDYNRRQAEGTK 465
            DPN PKRP SA+ +++   RE+ K DHP   S+  + K  GE WK MS+  K  +  KAE  + EYEK MK+Y   + + +K
Sbjct:  543 DPNAPKRPMSAYMLWLNASREKIKSDHP-GISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARREYEKAMKEYEGGRGDSSK 623          
The following BLAST results are available for this feature:
BLAST of CK933906 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
HMGB1_CALJA2.103e-1247.37High mobility group protein B1 OS=Callithrix jacch... [more]
HMGB1_BOVIN2.103e-1247.37High mobility group protein B1 OS=Bos taurus GN=HM... [more]
HMGB1_PIG2.746e-1247.37High mobility group protein B1 OS=Sus scrofa GN=HM... [more]
HMGB2_RAT3.587e-1247.37High mobility group protein B2 OS=Rattus norvegicu... [more]
HMGB2_PIG3.587e-1247.37High mobility group protein B2 OS=Sus scrofa GN=HM... [more]
HMGB2_HUMAN3.587e-1247.37High mobility group protein B2 OS=Homo sapiens GN=... [more]
HMGB2_BOVIN3.587e-1247.37High mobility group protein B2 OS=Bos taurus GN=HM... [more]
HMGB2_CHICK6.118e-1247.37High mobility group protein B2 OS=Gallus gallus GN... [more]
SSRP1_RAT1.044e-1142.68FACT complex subunit SSRP1 OS=Rattus norvegicus GN... [more]
SSRP1_MOUSE1.044e-1142.68FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933906 ID=CK933906|Name=CK933906|organism=Citrus sinensis|type=EST|length=847bp
GGGGACACAAACAACGCATCCGCTATTCACATCTGCGTCTCTCTCTTTTT
CTCTTTCCTCTTTTTCTCTCATTTGAAGCCCTAACCCTAGCTCTATCTTT
CTTCAGAAACAGGATTTGAAATGAAAGGAGGTAAATCAAAGTCAGACACC
AGAAACGCCAAGCTCTCTGTGAACAAGAAGCCTGCCAAAGCTGGACGAAA
ATCGGGAAAGGCAGCTAAGGACCCGAACAAGCCAAAGAGGCCAGCCAGCG
CCTTCTTTGTTTTCATGGAAGAATTCCGTGAACAATACAAGAAGGATCAT
CCTAAGAACAAATCAGTTGCTGCTGTTGGTAAAGCTGGTGGTGAGAAATG
GAAGTCAATGTCTGAAGCTGATAAAGCACCGTATGTTGCTAAGGCAGAGA
AGCGCAAGGTTGAGTATGAGAAGGATATGAAAGACTACAATAGGAGACAG
GCGGAGGGAACTAAGCCGGAGGAAGAAGAGGAGTCTGAGAAGTCTATGTC
AGAGGTGAATGATGAGGATGATGATGAAGAAGGCAGTGGCGAGGAGGATG
ATGATGAATAGAAGTTGAAGGAAGAAATTAGCATAGTCATGTTAGGCTGT
GACAATGTTTCAAACAACATATGTTAATGCTTTGTGCTTCCATGTTAATT
TTTTTGGATGCTTTCATCATCTTCATCATCATGTAAGAGAATCATGTTGC
TTCTCCCTCGACATTTTCTTATGCCTGCCTTTCAAAGAATTAATAGCTGT
AGGTGGGAGATTCACTGCTCTATATGTACTGTGTTCTAAAGCTTAATGAT
TTAGCTAAGGCGTTCCATCGTTTGTAAAAAAAAAAAAAAAAAAAAAA
back to top