CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_DANRE (ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.977e-40
Identity = 79/165 (47.88%), Postives = 113/165 (68.48%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD  GKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +LVFANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  ++  K
Sbjct:   16 QEVRILLLGLDNGGKTTLLKQLASEDITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_CAEEL (ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 6.977e-40
Identity = 80/180 (44.44%), Postives = 123/180 (68.33%), Query Frame = 2
Query:   98 LSFTKLFSRLFAK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + F K+  +  A+ +EMRIL++GLD AGKTT++ K  L E   TI PT+GF+++TV +K+    +WDVGGQ  +R  W++YF++T  LI+VVDS+DR+R+++  +EL ++L E+ L  A LLV ANK DLP A++   I   L LHS++  HW I S CA SG+ L + + WL +++ ++
Sbjct:    1 MGFLKILRKQRAREREMRILILGLDNAGKTTLMKKF-LDEPTDTIEPTLGFDIKTVHFKDFQLNLWDVGGQKSLRSYWKNYFESTDALIWVVDSSDRERLLQCSEELKKLLGEERLAGASLLVLANKSDLPGAIDVNSIAQVLDLHSIKSHHWKIFSCCALSGDRLVQAMTWLCDDVGSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_HUMAN (ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 9.112e-40
Identity = 79/165 (47.88%), Postives = 113/165 (68.48%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP W++YF+NT  LI+V+DS DR R  E   EL  +L E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4C_MOUSE (ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.554e-39
Identity = 86/177 (48.59%), Postives = 116/177 (65.54%), Query Frame = 2
Query:  119 SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-----ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            S + A + + I+M+GLD+AGKTT+LY+LK  E V T+PTIGFN E ++  N     IS   WDVGGQ+K+RPLW+ Y + T G+I+VVDS D DR+ EA+ ELH++    E +   LLV ANKQDLP ++  AEI  +L LH L     +++Q  CA  GEGL EG+D L   I  +
Sbjct:    6 SNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKR 182          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4C_HUMAN (ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.554e-39
Identity = 86/177 (48.59%), Postives = 116/177 (65.54%), Query Frame = 2
Query:  119 SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN-----ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            S + A + + I+M+GLD+AGKTT+LY+LK  E V T+PTIGFN E ++  N     IS   WDVGGQ+K+RPLW+ Y + T G+I+VVDS D DR+ EA+ ELH++    E +   LLV ANKQDLP ++  AEI  +L LH L     +++Q  CA  GEGL EG+D L   I  +
Sbjct:    6 SNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKR 182          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL14_HUMAN (ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.030e-39
Identity = 75/156 (48.08%), Postives = 114/156 (73.08%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEG 598
            K+ ++L++GLD+AGK+T+LYKLKL + +TTIPTIGFNVE +E  +N S TVWDVGGQ+K+R +W  Y +NT GL++VVDS D+ R+ E++ +   +L  + +++  +++ ANKQD+P A+ A +IT    +  L   R+WY+Q  CA +GEGL +G
Sbjct:   12 KQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQG 167          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5C_MOUSE (ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.651e-39
Identity = 77/173 (44.51%), Postives = 116/173 (67.05%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            MG    KL  R+F  +E ++++VGLD AGKTTILY+    E+V T  TIG NVE +  +   F +WD+GGQ+ +R  W  Y+ N + +I V+DS DR+R++  R+EL++ML  + L++A +L+FANKQD+ ++M  AEI+  L L +++   W+IQ  CA +GEGL  GL W+
Sbjct:    1 MGQLIAKLM-RIFGSQEHKVIIVGLDNAGKTTILYQFLTNEVVHTCSTIGSNVEEIVLRKTHFLMWDLGGQEALRSTWDTYYSNAEFVILVIDSTDRNRLLTTREELYKMLAHEALQNASVLIFANKQDVKDSMTTAEISQFLTLSAIKDHPWHIQGCCALTGEGLPAGLQWM 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_CAEBR (ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 5.906e-39
Identity = 80/180 (44.44%), Postives = 121/180 (67.22%), Query Frame = 2
Query:   98 LSFTKLFSRLFAK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + F K+  +  A+ +EMRIL++GLD AGKTT++ K  L E   TI PT+GF+++TV +K+    +WDVGGQ  +R  W++YF++T  LI+VVDS+DR+R+ +  +EL ++L E+ L  A LLV ANK DLP A++   I   L L S++  HW I S CA SGE L + + WL +++ ++
Sbjct:    1 MGFLKILRKQRAREREMRILILGLDNAGKTTLMKKF-LDEPTDTIEPTLGFDIKTVHFKDFQLNLWDVGGQKSLRSYWKNYFESTDALIWVVDSSDRERLTQCSEELKKLLQEERLSGASLLVLANKSDLPGAIDVNSIAQVLELQSIKTHHWKIFSCCALSGERLVQAMTWLCDDVGSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_DICDI (ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.714e-39
Identity = 76/166 (45.78%), Postives = 109/166 (65.66%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +KE+RILM+GLD AGKTTIL K    +I T  PT+GFN++T+ YK     +WD+GGQ  +R  WR+Y++    +I+V+DS+D  R+ + + EL ++L E++   A  LVFANKQDL  AM + EI+  L L  L   HW I S  A +G GL EG+DW+  +I ++
Sbjct:   14 EKELRILMLGLDNAGKTTILKKFNGEDISTISPTLGFNIQTLMYKEYKLNIWDIGGQKTLRSYWRNYYEENDAVIWVIDSSDIRRIDDCKFELKKLLEEEKFAGASFLVFANKQDLDGAMTSEEISKYLDLEQLNTHHWEIMSCSAVTGLGLEEGIDWVVKDIVSR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF5_ARATH (Probable ADP-ribosylation factor At2g18390 OS=Arabidopsis thaliana GN=At2g18390 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.316e-38
Identity = 79/167 (47.31%), Postives = 111/167 (66.47%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +KEMRILMVGLD +GKTTI+ K+   +     PT+GFN++T+ Y+  +  +WDVGGQ  IR  WR+YF+ T GL++VVDS+D  R+ + + EL  +L E+ L  + LL+ ANKQD+  A+   EI   L L S+ + RHW I    A +GEGL EG DWL  +IA++
Sbjct:   14 EKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTIIYQKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLAGSSLLILANKQDIQGALTPDEIGKVLNLESMDKSRHWKIVGCSAYTGEGLLEGFDWLVQDIASR 180          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL3_DANRE6.977e-4047.88ADP-ribosylation factor-like protein 3 OS=Danio re... [more]
ARL2_CAEEL6.977e-4044.44ADP-ribosylation factor-like protein 2 OS=Caenorha... [more]
ARL3_HUMAN9.112e-4047.88ADP-ribosylation factor-like protein 3 OS=Homo sap... [more]
ARL4C_MOUSE1.554e-3948.59ADP-ribosylation factor-like protein 4C OS=Mus mus... [more]
ARL4C_HUMAN1.554e-3948.59ADP-ribosylation factor-like protein 4C OS=Homo sa... [more]
ARL14_HUMAN2.030e-3948.08ADP-ribosylation factor-like protein 14 OS=Homo sa... [more]
ARL5C_MOUSE2.651e-3944.51ADP-ribosylation factor-like protein 5C OS=Mus mus... [more]
ARL2_CAEBR5.906e-3944.44ADP-ribosylation factor-like protein 2 OS=Caenorha... [more]
ARL2_DICDI7.714e-3945.78ADP-ribosylation factor-like protein 2 OS=Dictyost... [more]
ARF5_ARATH1.316e-3847.31Probable ADP-ribosylation factor At2g18390 OS=Arab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top