CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_CAEEL (ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 5.000e-38
Identity = 79/163 (48.47%), Postives = 111/163 (68.10%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            +E+RIL++GLD AGKTTIL +L   ++    PT GFNV+TV    +I   VWD+GGQ  IRP W +Y++N   LIFV+DSND+ R  E   EL  +L+E++LR   +L+FANKQDL  A ++ EIT KL L  LR R W+IQ+  A   EG+ +G+ W+++N+
Sbjct:   16 REIRILLLGLDNAGKTTILKQLSSEDVQHVTPTKGFNVKTVAAMGDIRLNVWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKLRKVPVLIFANKQDLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNL 178          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL2_DROME (ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arf84F PE=2 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 8.528e-38
Identity = 76/166 (45.78%), Postives = 107/166 (64.46%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            ++EMRIL++GLD AGKTTIL +     I T  PT+GFN++T+E+   +  +WDVGGQ  +R  WR+YF++T GL++VVDS DR R+     EL  +L E+ L  A LLV  NKQDLP A+++ EI + L L  +   HW +    A +GE L   +DWL  +IA +
Sbjct:   14 EREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4A_HUMAN (ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=2 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 7.220e-37
Identity = 78/181 (43.09%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  107 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            T + S L + +   I+++GLD AGKTT+LY+L+  E V T+PT GFN E ++      K ++F  WDVGGQ+K+RPLW+ Y + T G++FVVDS D +R+ EA+ ELH++    E +   +L+ ANKQDL N+++ +EI   L +  L     W++Q TCA  G+GL EGL+ L + I  +
Sbjct:    9 TSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKR 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4A_RAT (ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.429e-37
Identity = 78/181 (43.09%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  107 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            T + S L + +   I+++GLD AGKTT+LY+L+  E V T+PT GFN E ++      K ++F  WDVGGQ+K+RPLW+ Y + T G++FVVDS D +R+ EA+ ELH++    E +   +L+ ANKQDL N+++ +EI   L +  L     W++Q TCA  G+GL EGL+ L + I  +
Sbjct:    9 TSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKR 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4A_MOUSE (ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.429e-37
Identity = 78/181 (43.09%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  107 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            T + S L + +   I+++GLD AGKTT+LY+L+  E V T+PT GFN E ++      K ++F  WDVGGQ+K+RPLW+ Y + T G++FVVDS D +R+ EA+ ELH++    E +   +L+ ANKQDL N+++ +EI   L +  L     W++Q TCA  G+GL EGL+ L + I  +
Sbjct:    9 TSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKR 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4A_BOVIN (ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.429e-37
Identity = 78/181 (43.09%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  107 TKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            T + S L + +   I+++GLD AGKTT+LY+L+  E V T+PT GFN E ++      K ++F  WDVGGQ+K+RPLW+ Y + T G++FVVDS D +R+ EA+ ELH++    E +   +L+ ANKQDL N+++ +EI   L +  L     W++Q TCA  G+GL EGL+ L + I  +
Sbjct:    9 TSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKR 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL14_MOUSE (ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.112e-36
Identity = 73/157 (46.50%), Postives = 112/157 (71.34%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVD-SNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEG 598
            K+  IL++GLD+AGK+T+LY+LK  E + TIPTIGFNVE V+ + +++ TVWDVGGQ+K+R +W  Y +N QGL++VVD S  + R+ ++R E   +L  + +++  +++ ANKQDLP A++A +IT    +  L   R+WY+Q  CA +GEGL +G
Sbjct:   12 KQAHILLLGLDSAGKSTLLYRLKFAETLATIPTIGFNVEMVQLQSSLTLTVWDVGGQEKMRTVWDCYCENAQGLMYVVDCSEGKKRLEDSRKEFKHILKNEHIKNTPVVILANKQDLPGALSAEDITRMFKVKKLCSNRNWYVQPCCAVTGEGLDDG 168          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5C_HUMAN (Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=2 SV=4)

HSP 1 Score: 148.288 bits (373), Expect = 5.174e-35
Identity = 73/178 (41.01%), Postives = 110/178 (61.80%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA 625
            MG    KL S +F  +E  +++VGLD  GKTTILY+    E+V   PTIG NVE +      F +WD+   + +  +W  Y+ NT+ +I V+DS DRDR++  R+EL++ML  + L+DA +L+FANKQD+ ++M   EI+  L L +++   W+IQ  CA + EGL   L W+ +  A
Sbjct:    1 MGQLIAKLMS-IFGNQEHTVIIVGLDNEGKTTILYRFLTNEVVHMCPTIGSNVEEIILPKTHFFMWDIVRPEALSFIWNTYYSNTEFIILVIDSTDRDRLLTTREELYKMLAHEALQDASVLIFANKQDVKDSMRMVEISHFLTLSTIKDHSWHIQGCCALTREGLPARLQWMESQAA 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_PONAB (ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.380e-34
Identity = 72/167 (43.11%), Postives = 114/167 (68.26%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            KKE+ +L +GLD +GKTTI+ KLK     +   +PTIGF++E  +  ++SFTV+D+ GQ + R LW HY++  Q +IFV+DS+DR R+V A++EL  +LN  ++  R   +L FANK DL +A+ + +++  L L +++ + W+I ++ A  GEGL EG+DWL + I
Sbjct:   15 KKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQI 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_HUMAN (ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 4.380e-34
Identity = 72/167 (43.11%), Postives = 114/167 (68.26%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            KKE+ +L +GLD +GKTTI+ KLK     +   +PTIGF++E  +  ++SFTV+D+ GQ + R LW HY++  Q +IFV+DS+DR R+V A++EL  +LN  ++  R   +L FANK DL +A+ + +++  L L +++ + W+I ++ A  GEGL EG+DWL + I
Sbjct:   15 KKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQI 181          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL3_CAEEL5.000e-3848.47ADP-ribosylation factor-like protein 3 OS=Caenorha... [more]
ARL2_DROME8.528e-3845.78ADP-ribosylation factor-like protein 2 OS=Drosophi... [more]
ARL4A_HUMAN7.220e-3743.09ADP-ribosylation factor-like protein 4A OS=Homo sa... [more]
ARL4A_RAT9.429e-3743.09ADP-ribosylation factor-like protein 4A OS=Rattus ... [more]
ARL4A_MOUSE9.429e-3743.09ADP-ribosylation factor-like protein 4A OS=Mus mus... [more]
ARL4A_BOVIN9.429e-3743.09ADP-ribosylation factor-like protein 4A OS=Bos tau... [more]
ARL14_MOUSE6.112e-3646.50ADP-ribosylation factor-like protein 14 OS=Mus mus... [more]
ARL5C_HUMAN5.174e-3541.01Putative ADP-ribosylation factor-like protein 5C O... [more]
ARL6_PONAB4.380e-3443.11ADP-ribosylation factor-like protein 6 OS=Pongo ab... [more]
ARL6_HUMAN4.380e-3443.11ADP-ribosylation factor-like protein 6 OS=Homo sap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top