CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_MOUSE (ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.721e-34
Identity = 71/167 (42.51%), Postives = 115/167 (68.86%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            KKE+ +L +GLD +GKTTI+ KLK     +   +PTIGF++E  +  ++SFTV+D+ GQ + R LW HY+++ Q +IFV+DS+D+ R+V A++EL  +LN  ++  R   +L FANK DL +++ + +++  L L S++ + W+I ++ A  GEGL EG+DWL + I
Sbjct:   15 KKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQDQI 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4D_MOUSE (ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 7.471e-34
Identity = 73/169 (43.20%), Postives = 110/169 (65.09%), Query Frame = 2
Query:  143 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + ++++GLD+AGKT++LY+LK  E V ++PT GFN E +       + I+F VWDVGGQ+K+RPLWR Y + T GL+FVVDS + +R+ EA+ ELHR+    + +   +LV ANKQD P A++AAE+  +L +  L      ++Q+  A  G GL +GL+ L   I  +
Sbjct:   22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAEIERLEEAKVELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQACSAVDGLGLQQGLERLYEMILKR 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_BOVIN (ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.274e-33
Identity = 70/167 (41.92%), Postives = 113/167 (67.66%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            KKE+ +L +GLD +GKTTI+ KLK     +   +PTIGF+++  +  ++SFTV+D+ GQ + R LW HY++  Q +IFV+DS+D+ R+V A++EL  +LN  ++  R   +L FANK DL +A+ + +++  L L  ++ + W+I ++ A  GEGL EG+DWL + I
Sbjct:   15 KKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIQKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELRTLLNHPDIKHRRIPILFFANKMDLRDALTSVKVSQLLCLEDIKDKPWHICASDAIKGEGLQEGVDWLQDQI 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4D_PONAB (ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.274e-33
Identity = 72/169 (42.60%), Postives = 109/169 (64.50%), Query Frame = 2
Query:  143 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + ++++GLD+AGKT++LY+LK  E V ++PT GFN E +       + I+F VWDVGGQ+K+RPLWR Y + T GL+FVVD+ + +R+ EA+ ELHR+    + +   +LV ANKQD P A++AAE+  +L +  L      ++Q   A  G GL +GL+ L   I  +
Sbjct:   22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKR 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4D_HUMAN (ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 1.274e-33
Identity = 72/169 (42.60%), Postives = 109/169 (64.50%), Query Frame = 2
Query:  143 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + ++++GLD+AGKT++LY+LK  E V ++PT GFN E +       + I+F VWDVGGQ+K+RPLWR Y + T GL+FVVD+ + +R+ EA+ ELHR+    + +   +LV ANKQD P A++AAE+  +L +  L      ++Q   A  G GL +GL+ L   I  +
Sbjct:   22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKR 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL11_BOVIN (ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.274e-33
Identity = 70/160 (43.75%), Postives = 109/160 (68.12%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            + E +++M+GLD+AGKTT+LY+LK  ++V T+PT+GFNVE +E   ++S T+WDVGGQ ++R  W+ + + T  L++V+DS D  R+ EA  EL  +L++  +    LLV ANKQ++P A++  EI D+LGL     R W +++  A +G GL E L+ L
Sbjct:   10 RAEAQVVMMGLDSAGKTTLLYRLKGYQLVETLPTVGFNVEPLEEPGHVSLTLWDVGGQSQLRASWKDHLEGTDILVYVLDSTDEARLPEAVAELREVLDDPSVASVPLLVLANKQEVPQALSLPEIRDRLGLQGFLGRSWDLRACSALTGAGLPEALESL 169          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL4D_BOVIN (ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.174e-33
Identity = 73/169 (43.20%), Postives = 108/169 (63.91%), Query Frame = 2
Query:  143 MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEY-----KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-WYIQSTCATSGEGLYEGLDWLSNNIANK 631
            + ++++GLD+AGKT++LY+LK  E V +IPT GFN E +       + I+F VWDVGGQ+K+RPLWR Y + T GL+FVVD+ + +R+ EA+ ELHR+    + +   +LV ANKQD P A++AAE+  +L +  L      ++Q   A  G GL  GL+ L   I  +
Sbjct:   21 LHVVVIGLDSAGKTSLLYRLKFKEFVQSIPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELATATLTHVQGCSAVDGLGLQPGLERLYEMILKR 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL11_MOUSE (ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.708e-33
Identity = 69/160 (43.12%), Postives = 105/160 (65.62%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            K E +++M+GLD+AGKTTILYKLK  ++V T+PT+GFNVE +E   ++S T+WD+GGQ ++R  W+ Y +    L++V+DS D  R+ EA  EL  +L +  +     LV ANKQ+ P A+   EI ++LGL   ++  W +++  A +G+GL E L  L
Sbjct:   10 KAEAQVVMMGLDSAGKTTILYKLKGNQLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELKEVLEDPNMAGVPFLVLANKQEAPGALPLLEIRNRLGLEGFQKHCWELRACSALTGQGLQEALQSL 169          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL_SCHPO (ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe GN=alp41 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.403e-32
Identity = 69/177 (38.98%), Postives = 112/177 (63.28%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MGL  T L  +   ++E+R+L++GLD AGKTTIL  L   ++    PT GF + T+E + + FT+WD+GGQ  +R  W++YF++T+ +I+VVDS D  R+ E R+ L  +L E++L    +LV ANK D+  A+++ EI+  L +   +  HW I S  A +G  + + + WL+N++
Sbjct:    1 MGL-LTILRQQKLKEREVRVLLLGLDNAGKTTILKCLLNEDVNEVSPTFGFQIRTLEVEGLRFTIWDIGGQKTLRNFWKNYFESTEAIIWVVDSLDDLRLEECRNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYKSSHWRIFSVSALTGLNIKDAISWLANDL 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL3_PONAB (ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.139e-32
Identity = 71/165 (43.03%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            +E+RIL++GLD AGKTT+L +L   +I    PT GFN+++V+ +     VWD+GGQ KIRP W++YF+NT  L                 EL  +L E++L    +L+FANKQDL  A  A+EI + L LH++R R W IQS  A +GEG+ +G++W+  N+  K
Sbjct:   16 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDIL-----------------ELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK 163          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL6_MOUSE5.721e-3442.51ADP-ribosylation factor-like protein 6 OS=Mus musc... [more]
ARL4D_MOUSE7.471e-3443.20ADP-ribosylation factor-like protein 4D OS=Mus mus... [more]
ARL6_BOVIN1.274e-3341.92ADP-ribosylation factor-like protein 6 OS=Bos taur... [more]
ARL4D_PONAB1.274e-3342.60ADP-ribosylation factor-like protein 4D OS=Pongo a... [more]
ARL4D_HUMAN1.274e-3342.60ADP-ribosylation factor-like protein 4D OS=Homo sa... [more]
ARL11_BOVIN1.274e-3343.75ADP-ribosylation factor-like protein 11 OS=Bos tau... [more]
ARL4D_BOVIN2.174e-3343.20ADP-ribosylation factor-like protein 4D OS=Bos tau... [more]
ARL11_MOUSE3.708e-3343.13ADP-ribosylation factor-like protein 11 OS=Mus mus... [more]
ARL_SCHPO2.403e-3238.98ADP-ribosylation factor-like protein alp41 OS=Schi... [more]
ARL3_PONAB3.139e-3243.03ADP-ribosylation factor-like protein 3 OS=Pongo ab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top