CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL11_HUMAN (ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 9.133e-32
Identity = 68/160 (42.50%), Postives = 104/160 (65.00%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            K E +++M+GLD+AGKTT+LYKLK  ++V T+PT+GFNVE ++   ++S T+WDVGGQ  +R  W+ Y + T  L++V+DS D  R+ E+  EL  +LN+  +     LV ANKQ+ P+A+   +I ++L L   +   W ++   A +GEGL E L  L
Sbjct:   10 KAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSL 169          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_CAEBR (ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.920e-31
Identity = 78/189 (41.27%), Postives = 114/189 (60.32%), Query Frame = 2
Query:   98 LSFTKLFSRLFA--KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA*TTK 646
            + F    S LF   KK++ I++VGLD +GKTTIL +LK  E  +   +PT+G  V     +N+SF  +D+ GQ K R  W  YF ++QG+IFV+DS+DR R+   +DEL  +L+  ++  R   +++ ANK D+P AM  A+IT  LGL+  R   W I STCA +G+GL + +  LS+ I     T K
Sbjct:    1 MGFLSSLSNLFGMGKKDVNIVVVGLDNSGKTTILNQLKTPETRSQQIVPTVGHVVTNFSTQNLSFHAFDMAGQMKYRSTWESYFHSSQGVIFVLDSSDRVRMELLKDELWLVLDHKDVASRGIPVVILANKMDIPGAMTCADITAALGLNLHRSGTWSIHSTCALTGDGLDKAMQQLSSEIQKYLETRK 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL11_RAT (ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.722e-30
Identity = 64/151 (42.38%), Postives = 98/151 (64.90%), Query Frame = 2
Query:  146 RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYK-NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYE 595
            +++M+GLD AGKTTILYKLK   +V T+PT+GFNVE +E   ++S T+WD+GGQ ++R  W+ Y +    L++V+DS D  R+ EA  EL  +L +  +     LV ANKQ+ P+A+   EI ++L L   +   W +++  A +G+GL E
Sbjct:   12 QVVMLGLDCAGKTTILYKLKGNRLVDTLPTVGFNVEPLEAPGHVSLTLWDIGGQTQLRATWKDYLEGIDLLVYVLDSTDEARLPEAVAELEEVLEDPNMAGVPFLVLANKQEAPDALPLLEIRNRLDLERFQDHCWELRACSALTGQGLQE 162          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL6_CAEEL (ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.938e-30
Identity = 75/181 (41.44%), Postives = 111/181 (61.33%), Query Frame = 2
Query:   98 LSFTKLFSRLFA--KKEMRILMVGLDAAGKTTILYKLKLGEIVTT--IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDEL--RDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            + F    S LF   KK++ I++VGLD +GKTTIL +LK  E  +   +PT+G  V     +N+SF  +D+ GQ K R  W  YF ++QG+IFV+DS+DR R+   +DEL  ++   ++  R   +++ ANK D+P AM A++IT  LGL+  R   W I STCA +G+GL + +  LS  I
Sbjct:    1 MGFFSSLSSLFGLGKKDVNIVVVGLDNSGKTTILNQLKTPETRSQQIVPTVGHVVTNFSTQNLSFHAFDMAGQMKYRSTWESYFHSSQGVIFVLDSSDRLRMELLKDELMMVMEHKDVVSRGIPIVILANKMDIPGAMTASDITVALGLNLYRSGTWSIHSTCALTGDGLDKAMQQLSAEI 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL17_HUMAN (ADP-ribosylation factor-like protein 17 OS=Homo sapiens GN=ARL17 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.234e-28
Identity = 60/87 (68.97%), Postives = 69/87 (79.31%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQG 352
            MG  F KLF  L  KK+MRIL++ LD AGKTTILYKLKLGE V  +PT+GF VETVEYKN +F VWDVG   KIRPLW+H+FQNT+G
Sbjct:    1 MGNIFEKLFKSLLGKKKMRILILSLDTAGKTTILYKLKLGETVPAVPTVGFCVETVEYKNNTFAVWDVGSHFKIRPLWQHFFQNTKG 87          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: AR8BA_DANRE (ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.365e-27
Identity = 57/166 (34.34%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    ++++VD+ DR++V  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_RAT (ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.328e-27
Identity = 55/166 (33.13%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    +++++D+ DR+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_MOUSE (ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.328e-27
Identity = 55/166 (33.13%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    +++++D+ DR+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_HUMAN (ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.328e-27
Identity = 55/166 (33.13%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    +++++D+ DR+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8_DICDI (ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.040e-27
Identity = 63/171 (36.84%), Postives = 95/171 (55.56%), Query Frame = 2
Query:  101 SFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            S    F  LF K+EM + +VGL  +GKTT++  +  G  +  TIPTIGFN++ V   N++  +WD+GGQ + R +W  Y +    ++FVVDS DR++  +++  L  ++N+  L    LLV ANK DLPN+    E+   L L  +  R     S  A +   +   LDWL
Sbjct:    6 SIINFFKSLFWKQEMELTLVGLQGSGKTTLVNVISNGGFIEDTIPTIGFNMKKVTKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFVVDSADREKFEQSKQALQDLINKPPLAKIPLLVVANKNDLPNSAGVDEMIQNLDLRGIVGREVCCYSISAKNSVNIDITLDWL 176          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL11_HUMAN9.133e-3242.50ADP-ribosylation factor-like protein 11 OS=Homo sa... [more]
ARL6_CAEBR5.920e-3141.27ADP-ribosylation factor-like protein 6 OS=Caenorha... [more]
ARL11_RAT1.722e-3042.38ADP-ribosylation factor-like protein 11 OS=Rattus ... [more]
ARL6_CAEEL2.938e-3041.44ADP-ribosylation factor-like protein 6 OS=Caenorha... [more]
ARL17_HUMAN1.234e-2868.97ADP-ribosylation factor-like protein 17 OS=Homo sa... [more]
AR8BA_DANRE1.365e-2734.34ADP-ribosylation factor-like protein 8B-A OS=Danio... [more]
ARL8B_RAT2.328e-2733.13ADP-ribosylation factor-like protein 8B OS=Rattus ... [more]
ARL8B_MOUSE2.328e-2733.13ADP-ribosylation factor-like protein 8B OS=Mus mus... [more]
ARL8B_HUMAN2.328e-2733.13ADP-ribosylation factor-like protein 8B OS=Homo sa... [more]
ARL8_DICDI3.040e-2736.84ADP-ribosylation factor-like protein 8 OS=Dictyost... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top