CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_MACFA (ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.040e-27
Identity = 55/166 (33.13%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    +++++D+ DR+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRYRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_BOVIN (ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.773e-27
Identity = 54/166 (32.53%), Postives = 100/166 (60.24%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + + +W  Y +    +++++D+ DR+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFQSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8B_PONAB (ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.574e-26
Identity = 54/166 (32.53%), Postives = 99/166 (59.64%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  V   N++  +WD+GGQ + R +W  Y +    +++++D+  R+++  +R+ELH +L++ +L+   +LV  NK+DLPNA++  ++ +K+ L +++ R     S      + +   L WL
Sbjct:   12 FRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAAYREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8A_HUMAN (ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.361e-26
Identity = 56/173 (32.37%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  104 FTKL---FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F KL   F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N++  +WD+GGQ + R +W  Y +    ++++VD+ D++++  +++ELH +L++ +L+   +LV  NK+DLP A++  E+ +K+ L +++ R     S      + +   L WL
Sbjct:    5 FNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8A_CHICK (ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.390e-26
Identity = 56/173 (32.37%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  104 FTKL---FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F KL   F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N++  +WD+GGQ + R +W  Y +    ++++VD+ D++++  +++ELH +L++ +L+   +LV  NK+DLP A++  E+ +K+ L +++ R     S      + +   L WL
Sbjct:    5 FNKLLDWFRALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8A_XENTR (ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.734e-26
Identity = 55/173 (31.79%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  104 FTKL---FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F KL   F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N++  +WD+GGQ + R +W  Y +    ++++VD+ D+D++  +++ELH +L++ +L+   +LV  NK+D+P A++  E+ +++ L +++ R     S      + +   L WL
Sbjct:    5 FNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQDKIEASKNELHNLLDKAQLQGIPVLVLGNKRDIPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8_DROME (ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.277e-25
Identity = 54/166 (32.53%), Postives = 96/166 (57.83%), Query Frame = 2
Query:  116 FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F  +F K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N++  VWD+GGQ + R +W  Y +    ++++VD+ D D++  +R+ELH +L++ +L    +LV  NK+DLP A++   + +++ L S++ R     S      + +   L WL
Sbjct:   12 FKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL8A_MOUSE (ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.846e-25
Identity = 55/173 (31.79%), Postives = 101/173 (58.38%), Query Frame = 2
Query:  104 FTKL---FSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEI-VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F KL   F  LF K+EM + +VGL  +GKTT +  +  G+     IPT+GFN+  +   N++  +WD+GGQ + R +W  Y +    ++++VD+ D++++  +++ELH +L++ +L+   +LV  NK+DL  A++  E+ +K+ L +++ R     S      + +   L WL
Sbjct:    5 FNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_USTMA (Small COPII coat GTPase SAR1 OS=Ustilago maydis GN=SAR1 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.663e-23
Identity = 61/175 (34.86%), Postives = 91/175 (52.00%), Query Frame = 2
Query:  131 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH-----------SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            A K  +IL +GLD AGKTT+L+ LK   + T  PT+    E +    + FT +D+GG  + R LW+ YF    G++F+VD+ D +R  EAR EL  +L+ +EL     L+  NK D P A++  E+   +GL+            +R    ++ S     G G  EG  W+S  I
Sbjct:   17 AHKNAKILFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGQVKFTTYDLGGHQQARRLWKDYFPEVDGIVFLVDTQDHERFAEARAELDALLSIEELSSVPFLILGNKIDAPGAVSEEELRQAIGLYQTTGKGKVPLKDIRPIEIFMCSVVMRQGYG--EGFRWISQYI 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_YEAST (Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae GN=SAR1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 63/169 (37.28%), Postives = 88/169 (52.07%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-------QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT     E +   NI FT +D+GG  + R LW+ YF    G++F+VD+ D +R  EAR EL  + N  EL+D   ++  NK D PNA++ AE+   LGL +         QR   +         G  E   WLS  I
Sbjct:   22 KHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI 190          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL8B_MACFA3.040e-2733.13ADP-ribosylation factor-like protein 8B OS=Macaca ... [more]
ARL8B_BOVIN6.773e-2732.53ADP-ribosylation factor-like protein 8B OS=Bos tau... [more]
ARL8B_PONAB2.574e-2632.53ADP-ribosylation factor-like protein 8B OS=Pongo a... [more]
ARL8A_HUMAN3.361e-2632.37ADP-ribosylation factor-like protein 8A OS=Homo sa... [more]
ARL8A_CHICK4.390e-2632.37ADP-ribosylation factor-like protein 8A OS=Gallus ... [more]
ARL8A_XENTR5.734e-2631.79ADP-ribosylation factor-like protein 8A OS=Xenopus... [more]
ARL8_DROME1.277e-2532.53ADP-ribosylation factor-like protein 8 OS=Drosophi... [more]
ARL8A_MOUSE2.846e-2531.79ADP-ribosylation factor-like protein 8A OS=Mus mus... [more]
SAR1_USTMA2.663e-2334.86Small COPII coat GTPase SAR1 OS=Ustilago maydis GN... [more]
SAR1_YEAST5.934e-2337.28Small COPII coat GTPase SAR1 OS=Saccharomyces cere... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top