CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_CANGA (Small COPII coat GTPase SAR1 OS=Candida glabrata GN=SAR1 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 64/169 (37.87%), Postives = 87/169 (51.48%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-------QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT     E +   NI FT +D+GG  + R LW+ YF    G++F+VDS D DR  EAR EL  + N  EL+D   ++  NK D  NA++ AE+   LGL +         QR   +         G  E   WLS  I
Sbjct:   21 KHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKIDAANAVSEAELRSALGLLNTTGSQRIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFRP_BOVIN (ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.012e-22
Identity = 58/179 (32.40%), Postives = 98/179 (54.75%), Query Frame = 2
Query:  113 LFSRLFAKKEMRILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLG--LHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            L+  +F K E  +L++GLD AGKTT L          YK + L +I TT+   G N+ TV+        WD+GGQ++++ LW  Y+    G+I+V+DS D +R+ E++    +M+  + L    +LV ANKQD+   ++  +I          + +R    Q+  A +G+G+ EG++W+
Sbjct:    8 LYKYMFQKDEYCVLILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTV---GLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKQAFEKMVTSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCASKIGRRDCLTQACSALTGKGVREGIEWM 183          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_MAGGR (Small COPII coat GTPase SAR1 OS=Magnaporthe grisea GN=SAR1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.322e-22
Identity = 59/173 (34.10%), Postives = 92/173 (53.18%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH-----------SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   +    PT+    E +   N+ FT +D+GG  + R LW+ YF    G++F+VD+ D DR  EA+ EL  +L+ +EL     ++  NK D P A++  E+  +LGL+            +R    ++ S     G G  EG+ WLS  +
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRVAILQPTLHPTSEELAIGNVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAKDHDRFPEAKAELDALLSMEELAKVPFVILGNKIDHPEAISEEELRHQLGLYQTTGKGKVPLEGIRPIEVFMCSVVMRQGYG--EGIRWLSQYV 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFRP_RAT (ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.322e-22
Identity = 61/184 (33.15%), Postives = 103/184 (55.98%), Query Frame = 2
Query:  113 LFSRLFAKKEMRILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI-------TDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            L+  +F K E  IL++GLD AGKTT L          YK + L +I TT+   G N+ TV+        WD+GGQ++++ LW  Y+    G+I+V+DS D +R+ E+++   ++++ + L    +LV ANKQD+   ++  +I       T K+G     +R    Q+  A +G+G+ EG++W+
Sbjct:    8 LYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTV---GLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIG-----RRDCLTQACSALTGKGVREGIEWM 183          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFRP_PONAB (ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.322e-22
Identity = 61/184 (33.15%), Postives = 101/184 (54.89%), Query Frame = 2
Query:  113 LFSRLFAKKEMRILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI-------TDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            L+  +F K E  IL++GLD AGKTT L          YK + L +I TT+   G N+ TV+        WD+GGQ++++ LW  Y+    G+I+V+DS D +R+ E++    +++  + L    +LV ANKQD+   ++  +I       T K+G     +R    Q+  A +G+G+ EG++W+
Sbjct:    8 LYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTV---GLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIG-----RRDCLTQACSALTGKGVREGIEWM 183          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFRP_MOUSE (ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=2 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 1.322e-22
Identity = 61/184 (33.15%), Postives = 103/184 (55.98%), Query Frame = 2
Query:  113 LFSRLFAKKEMRILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI-------TDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            L+  +F K E  IL++GLD AGKTT L          YK + L +I TT+   G N+ TV+        WD+GGQ++++ LW  Y+    G+I+V+DS D +R+ E+++   ++++ + L    +LV ANKQD+   ++  +I       T K+G     +R    Q+  A +G+G+ EG++W+
Sbjct:    8 LYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTV---GLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVSSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIG-----RRDCLTQACSALTGKGVREGIEWM 183          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFRP_HUMAN (ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.322e-22
Identity = 61/184 (33.15%), Postives = 101/184 (54.89%), Query Frame = 2
Query:  113 LFSRLFAKKEMRILMVGLDAAGKTTIL----------YK-LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEI-------TDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            L+  +F K E  IL++GLD AGKTT L          YK + L +I TT+   G N+ TV+        WD+GGQ++++ LW  Y+    G+I+V+DS D +R+ E++    +++  + L    +LV ANKQD+   ++  +I       T K+G     +R    Q+  A +G+G+ EG++W+
Sbjct:    8 LYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTV---GLNIGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIG-----RRDCLTQACSALTGKGVREGIEWM 183          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1B_DICDI (GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.255e-22
Identity = 56/169 (33.14%), Postives = 101/169 (59.76%), Query Frame = 2
Query:  128 FAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLI-FVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITD-------KLGLHSLRQRHWYIQSTCATSGEGLYEGLDWL 610
            F KKE +I+++GL  AGKTT+L+ L  G + + IPT+  N E+  Y N++F  +D+GGQ  +R LW+ Y  +++ +I F+VDS+D + ++E++ E+H +L ++ L  + LL+  +K D     N   + D       +LGL++     + +  T + +  G+ + L+WL
Sbjct:   16 FFKKEAKIVIIGLGNAGKTTLLHLLVTGSLKSHIPTLRPNAESFTYGNVNFKAYDLGGQQNLRFLWKQYVPDSKTIIVFMVDSSDYNSIIESKSEIHDILGDEHLSQSPLLILGSKCDAKGHHNRENLIDLLDIRRFELGLNNSNNVPFDLIMTSSITRYGITDMLNWL 184          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_PICST (Small COPII coat GTPase SAR1 OS=Pichia stipitis GN=SAR1 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.945e-22
Identity = 60/174 (34.48%), Postives = 90/174 (51.72%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL------------RQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT+    E +   ++ FT +D+GG  + R LW+ YF    G++F+VD+ D +R  E++ EL  +   +EL     L+  NK D+P A+   E+   LGL++             R    Y+ S    SG G  EG  WLS  I
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGSVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAADPERFAESKAELESLFKIEELSHVPFLILGNKIDVPTAVGEMELKSALGLYNTTGKDTGKLPEGSRPIEVYMVSVVMRSGYG--EGFKWLSQYI 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_TRIRE (Small COPII coat GTPase sar1 OS=Trichoderma reesei GN=sar1 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.846e-22
Identity = 57/173 (32.95%), Postives = 94/173 (54.34%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH-----------SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   +    PT+    E +   N+ F  +D+GG  + R +WR YF +  G++F+VD+ D +R  EA+ EL  +L+ +EL     ++  NK D P+A++  E+  +LGL+            +R    ++ S     G G  +G+ WLSN +
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRVAILQPTLHPTSEELAIGNVRFNTFDLGGHQQARRIWRDYFPDVNGVVFLVDAKDHERFPEAKAELDALLSMEELSKVPFVILGNKIDHPDAVSEDELRHQLGLYQTTGKGRVQLEGIRPIELFMCSVVMRQGYG--DGIRWLSNYV 189          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
SAR1_CANGA5.934e-2337.87Small COPII coat GTPase SAR1 OS=Candida glabrata G... [more]
ARFRP_BOVIN1.012e-2232.40ADP-ribosylation factor-related protein 1 OS=Bos t... [more]
SAR1_MAGGR1.322e-2234.10Small COPII coat GTPase SAR1 OS=Magnaporthe grisea... [more]
ARFRP_RAT1.322e-2233.15ADP-ribosylation factor-related protein 1 OS=Rattu... [more]
ARFRP_PONAB1.322e-2233.15ADP-ribosylation factor-related protein 1 OS=Pongo... [more]
ARFRP_MOUSE1.322e-2233.15ADP-ribosylation factor-related protein 1 OS=Mus m... [more]
ARFRP_HUMAN1.322e-2233.15ADP-ribosylation factor-related protein 1 OS=Homo ... [more]
SAR1B_DICDI2.255e-2233.14GTP-binding protein Sar1B OS=Dictyostelium discoid... [more]
SAR1_PICST2.945e-2234.48Small COPII coat GTPase SAR1 OS=Pichia stipitis GN... [more]
SAR1_TRIRE3.846e-2232.95Small COPII coat GTPase sar1 OS=Trichoderma reesei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top