CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_DEBHA (Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii GN=SAR1 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.600e-20
Identity = 55/172 (31.98%), Postives = 86/172 (50.00%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR----------QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT+    E +   ++ FT +D+GG  + R LW+ YF    G++F+VD+ D +R  E++ EL  +   +EL     L+  NK D  +A+   E+   LGL++            QR   +         G  +G  WLS  I
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRLATLQPTLHPTSEELAIGSVRFTTFDLGGHQQARRLWKDYFPEVNGIVFLVDAADPERFAESKAELESLFKIEELASVPFLILGNKIDASSAVGEMELKSALGLYNTTGKDTGKLPEGQRPIEVFMVSVVMRMGYGDGFKWLSQYI 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_SCHPO (Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe GN=sar1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.701e-20
Identity = 57/174 (32.76%), Postives = 89/174 (51.15%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH------------SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   +    PT+    E +   N+ FT +D+GG  + R LWR YF    G++++VD  D +R+ E++ EL  +L  +EL     L+  NK D P A++  E+   LGL+             +R    ++ S     G G  EG  WL+  +
Sbjct:   19 KHAKMLFLGLDNAGKTTLLHMLKNDRLAVMQPTLHPTSEELAIGNVRFTTFDLGGHQQARRLWRDYFPEVNGIVYLVDCCDFERLSESKAELDALLAMEELARVPFLILGNKIDAPGAISEDELKAALGLYQTTGKGVSKPVPGIRPIEVFMCSVVLRQGYG--EGFKWLAQYV 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR2_SOLLC (GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.019e-20
Identity = 50/131 (38.17%), Postives = 78/131 (59.54%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL 526
            +K+ +IL +GLD AGKTT+L+ LK   +V   PT     E +   NI F  +D+GG    R +WR Y+     ++++VD+NDR+R  EA+ EL  +L+++ L +   L+  NK D+P A +  E+   LGL
Sbjct:   18 QKDAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGNIKFKAFDLGGHQIARRVWRDYYAKVDAVVYLVDANDRERFPEAKKELDGLLSDESLTNVPFLILGNKIDIPYAASEDELRYHLGL 148          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_PICPG (Small COPII coat GTPase SAR1 OS=Pichia pastoris (strain GS115) GN=SAR1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.019e-20
Identity = 58/172 (33.72%), Postives = 89/172 (51.74%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR----------QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT     E +   N+ FT +D+GG ++ R +W+ YF    G++++VD  D +R  E+R EL  +L  +EL    +LV  NK D   A++  E+   LGL +            QR   + +      +G  EG+ WLS  I
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELSIGNVRFTTFDLGGHEQARRVWKDYFPEVDGIVYLVDIADPERFEESRVELDALLKIEELSKVPVLVLGNKIDKSTAVSENELRHALGLMTTTGKDKVQLVEGQRPLEVFTCSIYLRQGYGEGIRWLSQYI 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_ASHGO (Small COPII coat GTPase SAR1 OS=Ashbya gossypii GN=SAR1 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 58/169 (34.32%), Postives = 85/169 (50.30%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-------QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   + T  PT     E +   +I FT +D+GG  + R LW+ YF    G++F+VD+ D +R  EAR EL  +    EL+    ++  NK D P+A++  E+   LGL +         QR   +         G  E   WLS  I
Sbjct:   22 KHGKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGSIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKIDAPSAVSETELRAALGLLNTTGDARIEGQRPVELFMCSVVMKSGYLEAFQWLSQYI 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL15_PONAB (ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = 2
Query:  131 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS-NDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            A+ E  ++ +GL  +GKT++L KL        + T GF+++ V ++N    V ++GG D IR  W  Y+Q +QG+IFV+DS +  D +  AR+ELH  L   +L     L+ AN QD P A +  EI     L  L R + W +Q       + L +    L N +  K
Sbjct:   29 ARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEK 197          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL15_HUMAN (ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = 2
Query:  131 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS-NDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            A+ E  ++ +GL  +GKT++L KL        + T GF+++ V ++N    V ++GG D IR  W  Y+Q +QG+IFV+DS +  D +  AR+ELH  L   +L     L+ AN QD P A +  EI     L  L R + W +Q       + L +    L N +  K
Sbjct:   29 ARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEK 197          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL15_BOVIN (ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 56/164 (34.15%), Postives = 86/164 (52.44%), Query Frame = 2
Query:  131 AKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDS-NDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL-RQRHWYIQSTCATSGEGLYEGLDWLSN 616
            A+ E  ++ +GL  +GKT++L KL      + + T GF+++ V ++N    V ++GG D IR  W  Y+Q +QG+IFV+DS +  D +  AR+ELH  L   +L     L+ AN QD P A +  E+     L  L R + W +Q       E L +    L N
Sbjct:   29 ARPEYDLVCIGLTGSGKTSLLSKLCSESPDSVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEVKKYFELEPLARGKRWILQPCSLDDMEALKDSFSQLIN 192          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_ASPNG (Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.368e-19
Identity = 56/173 (32.37%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLH-----------SLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            K  ++L +GLD AGKTT+L+ LK   +    PT     E +   N  FT +D+GG  + R LW+ YF    G++F+VD+ D +   E++ EL  +L  +EL     L+  NK D P+A++  ++  +LGL+            +R    ++ S     G G  EG+ WLS  +
Sbjct:   19 KHAKLLFLGLDNAGKTTLLHMLKNDRVAILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHECFPESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDDVRHQLGLYQTTGKGKVPLEGIRPIEVFMCSVVMRQGYG--EGIRWLSQYV 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1A_DICDI (GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.368e-19
Identity = 60/183 (32.79%), Postives = 97/183 (53.01%), Query Frame = 2
Query:   98 LSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPN--------AMNAAEIT--DKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSN 616
            LSF  L++     K  +IL +GLD AGKTT+L  LK G + + +PT     E +   NI F  +D+GG +  R LW+ Y+ +   +++++DS+ +DR VE++ EL  +L+ DEL +   L+  NK D+ N        ++   + T   K  L+ +R    ++ S       G  EG  WL+N
Sbjct:   11 LSFLGLYN-----KNAKILFLGLDNAGKTTLLGVLKDGRLSSYLPTFHPTSEELAMGNIRFKAFDLGGHESARRLWKDYYPSVDAIVYLIDSSAQDRFVESKKELDSLLSSDELANVPFLILGNKVDIGNTSEEKFRASLGLTQTTGKGKTTLNGVRPIEVFMCS--VVKRYGYAEGFRWLAN 186          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
SAR1_DEBHA3.600e-2031.98Small COPII coat GTPase SAR1 OS=Debaryomyces hanse... [more]
SAR1_SCHPO4.701e-2032.76Small COPII coat GTPase sar1 OS=Schizosaccharomyce... [more]
SAR2_SOLLC8.019e-2038.17GTP-binding protein SAR2 OS=Solanum lycopersicum G... [more]
SAR1_PICPG8.019e-2033.72Small COPII coat GTPase SAR1 OS=Pichia pastoris (s... [more]
SAR1_ASHGO1.047e-1934.32Small COPII coat GTPase SAR1 OS=Ashbya gossypii GN... [more]
ARL15_PONAB1.047e-1933.73ADP-ribosylation factor-like protein 15 OS=Pongo a... [more]
ARL15_HUMAN1.047e-1933.73ADP-ribosylation factor-like protein 15 OS=Homo sa... [more]
ARL15_BOVIN1.047e-1934.15ADP-ribosylation factor-like protein 15 OS=Bos tau... [more]
SAR1_ASPNG1.368e-1932.37Small COPII coat GTPase SAR1 OS=Aspergillus niger ... [more]
SAR1A_DICDI1.368e-1932.79GTP-binding protein Sar1A OS=Dictyostelium discoid... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top