CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL10_HUMAN (ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.672e-17
Identity = 51/134 (38.06%), Postives = 79/134 (58.96%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLK-LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL 535
            ++  +L++GLD AGK+T L  L     +   IPT GFN   +  K+    + ++GG   +R  W+ +      L+FVVDS DR R+  AR ELH++L++D   D  ++V ANKQDL  AM+  E+  +LGL ++
Sbjct:   76 EQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDP--DLPVVVVANKQDLSEAMSMGELQRELGLQAI 207          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: CIN4_YEAST (GTP-binding protein CIN4 OS=Saccharomyces cerevisiae GN=CIN4 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.865e-17
Identity = 49/137 (35.77%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLKLGEIVTT---IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELR---DAVLLVFANKQDLPNAMNAAEITDKLGLH 529
            KE+R L++GLD +GK+TI+ KL   +       +PT+GF + ++  K+++ ++WD+GGQ  +RP W +YF  TQ +I+ +D +   R  E   EL  ++N DE R   +  ++V  NK DL        + DK  LH
Sbjct:   15 KEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVIVVLNKIDL--------VEDKSELH 143          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL10_MOUSE (ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.354e-17
Identity = 54/156 (34.62%), Postives = 86/156 (55.13%), Query Frame = 2
Query:  137 KEMRILMVGLDAAGKTTILYKLK-LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLG-LHSLRQRH-WYIQSTCATSGEGLYE 595
            ++  +L++GLD +GK+T L  L     +   +PT GFN   +  KN    + ++G    +R  W+ +      L+F+VDS DR R+  AR EL ++L+ D   D  +++ ANKQDL  AMN  E+  +LG L S  QR  + + ++ A +G G  E
Sbjct:   75 EQREVLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKNFEVDLLEIGDSQNLRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDRDP--DLPVVIVANKQDLSGAMNMVELQQELGLLASYNQREVFLLAASIAPAGSGFGE 228          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARLX_DICDI (ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.415e-16
Identity = 52/141 (36.88%), Postives = 82/141 (58.16%), Query Frame = 2
Query:   98 LSFTK-LFSRLFAKKEMRILMVGLDAAGKTTILYKLK--LGEIVTT---------IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYF-QNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDL 481
            +SF K LF  L  KK   ++++G++  GKTT+LY +     E +TT         IPT GFNVE++  + + F +WD+GG++  R  +RHY       +IFV DS+D + + E++ E   + N+  L++   L+ ANKQDL
Sbjct:    5 ISFIKNLFGFLTIKK---VMILGVENVGKTTLLYNIYKFYSENITTTTLSSLPIPIPTNGFNVESIVIEQVKFDIWDIGGKETNRICYRHYLTSEIDSIIFVFDSSDINSLEESKKEYQYLKNQISLKNVPFLLVANKQDL 142          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL9_HUMAN (ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 4.554e-15
Identity = 47/132 (35.61%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL 526
            +K  +IL++GLD AGKT++L+ L    +  ++ PT GF+   +  ++      ++GG    R  W  Y      LIFVVDS D  R+ EA+  LH+++  + +    L+VFANKQDL  A +  +I + L L
Sbjct:   16 EKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEIGGSKPFRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPV--LPLVVFANKQDLEAAYHITDIHEALAL 145          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_TOBAC (GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.608e-12
Identity = 36/98 (36.73%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  134 KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLN 427
            +KE +IL +GLD AGKTT+L+ LK   +V   PT     E +    I F  +D+GG    R +W+ Y+     ++++VDS D++R  E++ EL  +L+
Sbjct:   18 QKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDSFDKERFAESKKELDALLS 115          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: SAR1_ENCCU (Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi GN=SAR1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.608e-12
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDL 481
            F      LF K    IL +G+D AGKTT++ KLK       +PT   +   +E  N+   V D+GG    R  WR YF +  G++F+VD +D +R  E R+    +L+ +  + A ++V  NK DL
Sbjct:   24 FQNFVKSLFGKPSS-ILFLGIDNAGKTTLVNKLKSDSTDVYMPTHHPSTSYIEIGNLKAQVIDLGGHTAARLAWRDYFYDCHGIVFIVDVHDVERFQEVREAYETVLSLE--KRAPVVVLMNKIDL 146          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARL10_HUMAN1.672e-1738.06ADP-ribosylation factor-like protein 10 OS=Homo sa... [more]
CIN4_YEAST4.865e-1735.77GTP-binding protein CIN4 OS=Saccharomyces cerevisi... [more]
ARL10_MOUSE6.354e-1734.62ADP-ribosylation factor-like protein 10 OS=Mus mus... [more]
ARLX_DICDI2.415e-1636.88ADP-ribosylation factor-like protein DDB_G0292332 ... [more]
ARL9_HUMAN4.554e-1535.61ADP-ribosylation factor-like protein 9 OS=Homo sap... [more]
SAR1_TOBAC3.608e-1236.73GTP-binding protein SAR1 OS=Nicotiana tabacum GN=S... [more]
SAR1_ENCCU3.608e-1234.92Small COPII coat GTPase SAR1 OS=Encephalitozoon cu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top