CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_XENLA (ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=2 SV=2)

HSP 1 Score: 305.064 bits (780), Expect = 3.307e-82
Identity = 147/180 (81.67%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSRLF KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ EA +EL +ML EDELRDAVLLVFANKQDLPNAM  +E+TDKL L +LR R WY+Q+TCAT G GLYEGLDWLSN ++ +
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLVFANKQDLPNAMAISEMTDKLTLQTLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF5_RAT (ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 9.623e-82
Identity = 145/180 (80.56%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSR+F KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV E+ DEL +ML EDELRDAVLLVFANKQD+PNAM  +E+TDKLGL  LR R WY+Q+TCAT G GLY+GLDWLS+ ++ +
Sbjct:    1 MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF5_MOUSE (ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=2 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 9.623e-82
Identity = 145/180 (80.56%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSR+F KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV E+ DEL +ML EDELRDAVLLVFANKQD+PNAM  +E+TDKLGL  LR R WY+Q+TCAT G GLY+GLDWLS+ ++ +
Sbjct:    1 MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF5_HUMAN (ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 9.623e-82
Identity = 145/180 (80.56%), Postives = 162/180 (90.00%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSR+F KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV E+ DEL +ML EDELRDAVLLVFANKQD+PNAM  +E+TDKLGL  LR R WY+Q+TCAT G GLY+GLDWLS+ ++ +
Sbjct:    1 MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_PONAB (ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3)

HSP 1 Score: 301.982 bits (772), Expect = 2.800e-81
Identity = 145/180 (80.56%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSRLF KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQD+IRPLW+HYFQNTQGLIFVVDSNDR+R+ E  DEL +ML  DELRDAVLL+FANKQDLPNAM  +E+TDKLGL SLR R WY+Q+TCAT G GLYEGLDWLSN ++ +
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_HUMAN (ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3)

HSP 1 Score: 301.982 bits (772), Expect = 2.800e-81
Identity = 145/180 (80.56%), Postives = 161/180 (89.44%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSRLF KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQD+IRPLW+HYFQNTQGLIFVVDSNDR+R+ E  DEL +ML  DELRDAVLL+FANKQDLPNAM  +E+TDKLGL SLR R WY+Q+TCAT G GLYEGLDWLSN ++ +
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF2_YEAST (ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae GN=ARF2 PE=1 SV=3)

HSP 1 Score: 301.982 bits (772), Expect = 2.800e-81
Identity = 142/181 (78.45%), Postives = 165/181 (91.16%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA 634
            MGL  +KLFS LF  KEMRILMVGLD AGKTT+LYKLKLGE++TTIPTIGFNVETV+YKNISFTVWDVGGQD+IR LWRHY++NT+G+IFV+DSNDR R+ EAR+ + RMLNEDELR+AV LVFANKQDLP AM+AAEIT+KLGLHS+R R W+IQSTCATSGEGLYEGL+WLSNN+ N++
Sbjct:    1 MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQS 181          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF5_CHICK (ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2)

HSP 1 Score: 301.597 bits (771), Expect = 3.657e-81
Identity = 143/180 (79.44%), Postives = 163/180 (90.56%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + +FSR+F KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+RV E+ +EL +ML EDELRDAVLLVFANKQD+PNAM  +E+TDKLGL +LR R WY+Q+TCAT G GLY+GLDWLS+ ++ +
Sbjct:    1 MGLTVSAIFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESAEELQKMLQEDELRDAVLLVFANKQDMPNAMVVSELTDKLGLQALRSRTWYVQATCATQGTGLYDGLDWLSHELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_RAT (ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 1.390e-80
Identity = 145/180 (80.56%), Postives = 160/180 (88.89%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSRLF KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ E    L +ML EDEL+DAVLL+FANKQDLPNAM  +E+TDKLGL SLR R WY+Q+TCAT G GLYEGLDWLSN ++ +
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_MOUSE (ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=2 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 1.390e-80
Identity = 145/180 (80.56%), Postives = 160/180 (88.89%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MGL+ + LFSRLF KK+MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI FTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDR+R+ E    L +ML EDEL+DAVLL+FANKQDLPNAM  +E+TDKLGL SLR R WY+Q+TCAT G GLYEGLDWLSN ++ +
Sbjct:    1 MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR 180          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARF4_XENLA3.307e-8281.67ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf... [more]
ARF5_RAT9.623e-8280.56ADP-ribosylation factor 5 OS=Rattus norvegicus GN=... [more]
ARF5_MOUSE9.623e-8280.56ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 ... [more]
ARF5_HUMAN9.623e-8280.56ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 ... [more]
ARF4_PONAB2.800e-8180.56ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 ... [more]
ARF4_HUMAN2.800e-8180.56ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 ... [more]
ARF2_YEAST2.800e-8178.45ADP-ribosylation factor 2 OS=Saccharomyces cerevis... [more]
ARF5_CHICK3.657e-8179.44ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5... [more]
ARF4_RAT1.390e-8080.56ADP-ribosylation factor 4 OS=Rattus norvegicus GN=... [more]
ARF4_MOUSE1.390e-8080.56ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top