CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_PLAFA (ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=2 SV=3)

HSP 1 Score: 298.13 bits (762), Expect = 4.043e-80
Identity = 136/179 (75.98%), Postives = 168/179 (93.85%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 628
            MGL  ++LF+RLF KK++RILMVGLDAAGKTTILYK+KLGE+VTTIPTIGFNVETVE++NISFTVWDVGGQDKIRPLWRHY+ NT GLIFVVDSNDR+R+ +AR+ELHRM+NE+EL+DA++LVFANKQDLPNAM+AAE+T+KL L+++R+R+W+IQSTCAT G+GLYEG DWL+ ++ N
Sbjct:    1 MGLYVSRLFNRLFQKKDVRILMVGLDAAGKTTILYKVKLGEVVTTIPTIGFNVETVEFRNISFTVWDVGGQDKIRPLWRHYYSNTDGLIFVVDSNDRERIDDAREELHRMINEEELKDAIILVFANKQDLPNAMSAAEVTEKLHLNTIRERNWFIQSTCATRGDGLYEGFDWLTTHLNN 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_YEAST (ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae GN=ARF1 PE=1 SV=3)

HSP 1 Score: 296.975 bits (759), Expect = 9.007e-80
Identity = 140/179 (78.21%), Postives = 162/179 (90.50%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 628
            MGL  +KLFS LF  KEMRILMVGLD AGKTT+LYKLKLGE++TTIPTIGFNVETV+YKNISFTVWDVGGQD+IR LWRHY++NT+G+IFVVDSNDR R+ EAR+ + RMLNEDELR+A  LVFANKQDLP AM+AAEIT+KLGLHS+R R W+IQ+TCATSGEGLYEGL+WLSN++ N
Sbjct:    1 MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKN 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_PLAFO (ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2)

HSP 1 Score: 295.434 bits (755), Expect = 2.621e-79
Identity = 135/179 (75.42%), Postives = 167/179 (93.30%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAN 628
            MGL  ++LF+RLF KK++RILMVGLDAAGKTTILYK+KLGE+VTTIPTIGFNVETVE++NISFTVWDVGGQDKIRPLWRHY+ NT GLIFVVDSNDR+R+ +AR+ LHRM+NE+EL+DA++LVFANKQDLPNAM+AAE+T+KL L+++R+R+W+IQSTCAT G+GLYEG DWL+ ++ N
Sbjct:    1 MGLYVSRLFNRLFQKKDVRILMVGLDAAGKTTILYKVKLGEVVTTIPTIGFNVETVEFRNISFTVWDVGGQDKIRPLWRHYYSNTDGLIFVVDSNDRERIDDAREGLHRMINEEELKDAIILVFANKQDLPNAMSAAEVTEKLHLNTIRERNWFIQSTCATRGDGLYEGFDWLTTHLNN 179          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF_GIALA (ADP-ribosylation factor OS=Giardia lamblia PE=3 SV=3)

HSP 1 Score: 271.937 bits (694), Expect = 3.103e-72
Identity = 128/182 (70.33%), Postives = 156/182 (85.71%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRD--RVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG   +K+F +LF+KKE+RILMVGLDAAGKTTILYKL LGE+VTT+PTIGFNVETVEYKNI+FTVWDVGGQD IRPLWRHY+QNT  LI+V+DS D +  R+ +A++ELH +L EDELRDA LLVFANKQDLP AM+  ++T++LGL  L++R WYIQ TCA SG+GLY+GLDWLS+ I +K
Sbjct:    1 MGQGASKIFGKLFSKKEVRILMVGLDAAGKTTILYKLMLGEVVTTVPTIGFNVETVEYKNINFTVWDVGGQDSIRPLWRHYYQNTDALIYVIDSADLEPKRIEDAKNELHTLLGEDELRDAALLVFANKQDLPKAMSTTDLTERLGLQELKKRDWYIQPTCARSGDGLYQGLDWLSDYIFDK 182          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_RAT (ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.304e-70
Identity = 122/170 (71.76%), Postives = 147/170 (86.47%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GLYEGL WL++N
Sbjct:    3 KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_PIG (ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.304e-70
Identity = 122/170 (71.76%), Postives = 147/170 (86.47%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GLYEGL WL++N
Sbjct:    3 KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_MOUSE (ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.304e-70
Identity = 122/170 (71.76%), Postives = 147/170 (86.47%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GLYEGL WL++N
Sbjct:    3 KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_HUMAN (ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 1.304e-70
Identity = 122/170 (71.76%), Postives = 147/170 (86.47%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GLYEGL WL++N
Sbjct:    3 KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_XENLA (ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 2.224e-70
Identity = 122/170 (71.76%), Postives = 146/170 (85.88%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+FS++F  KEMRILM GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CA SG+GLYEGL WL++N
Sbjct:    3 KMFSKIFGNKEMRILMRGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCPDRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCAASGDGLYEGLTWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF6_CHICK (ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3)

HSP 1 Score: 265.388 bits (677), Expect = 2.904e-70
Identity = 121/170 (71.18%), Postives = 147/170 (86.47%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            K+ S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CAT+G+GLYEGL WL++N
Sbjct:    3 KVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSN 172          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARF1_PLAFA4.043e-8075.98ADP-ribosylation factor 1 OS=Plasmodium falciparum... [more]
ARF1_YEAST9.007e-8078.21ADP-ribosylation factor 1 OS=Saccharomyces cerevis... [more]
ARF1_PLAFO2.621e-7975.42ADP-ribosylation factor 1 OS=Plasmodium falciparum... [more]
ARF_GIALA3.103e-7270.33ADP-ribosylation factor OS=Giardia lamblia PE=3 SV... [more]
ARF6_RAT1.304e-7071.76ADP-ribosylation factor 6 OS=Rattus norvegicus GN=... [more]
ARF6_PIG1.304e-7071.76ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE... [more]
ARF6_MOUSE1.304e-7071.76ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 ... [more]
ARF6_HUMAN1.304e-7071.76ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 ... [more]
ARF6_XENLA2.224e-7071.76ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf... [more]
ARF6_CHICK2.904e-7071.18ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top