CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_DROME (ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3)

HSP 1 Score: 263.077 bits (671), Expect = 1.441e-69
Identity = 122/170 (71.76%), Postives = 146/170 (85.88%), Query Frame = 2
Query:  110 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            KL S++F  KEMRILM+GLDAAGKTTILYKLKLG+ VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGLIFVVD  DRDR+ EAR ELHR++N+ E+RDA++L+FANKQDLP+AM   EI +KLGL  +R R+WY+Q +CATSG+GL EGL WL++N
Sbjct:    3 KLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSN 172          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF4_ARATH (Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3)

HSP 1 Score: 257.299 bits (656), Expect = 7.909e-68
Identity = 122/180 (67.78%), Postives = 148/180 (82.22%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F+++  R   K ++RILMVGLD +GKTTILYKLKLGE+VTT+PTIGFN+ETVEYK I+FTVWD+GGQ+KIR LWRHYFQN QGLIFVVDS+D +R+ EAR+ELHR+L ++EL  A +LVFANKQD  NA+  AE+ +KLGLHSL +R W IQ T A SG+GLYEGL+WLS  I NK
Sbjct:    1 MGARFSRIAKRFLPKSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTVWDIGGQEKIRKLWRHYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDSRNALPVAEVANKLGLHSLSKRCWLIQGTSAISGQGLYEGLEWLSTTIPNK 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF2_SCHPO (Probable ADP-ribosylation factor OS=Schizosaccharomyces pombe GN=SPBC1539.08 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.649e-65
Identity = 120/172 (69.77%), Postives = 141/172 (81.98%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 619
            F+K FSRLF+ KEMRILM+GLDAAGKTTILYKLKL + V TIPT+GFNVETV YKNI F VWDVGGQDKIRPLWRHYF  T+GLIFVVDS D +R+ EAR ELHR++++ E+RD +LLV ANKQDLP A++ A+ITD L L  L+ R W +Q TCA +G+GL EGL WLS N
Sbjct:    9 FSKPFSRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQN 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF3_ARATH (ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 7.660e-63
Identity = 110/177 (62.15%), Postives = 141/177 (79.66%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT++FS +F  KE RIL++GLD AGKTTILY+L++GE+V+TIPTIGFNVETV+Y NI F VWD+GGQ  IRP WR YF NTQ +I+VVDS+D DR+  A++E H +L EDEL+ AV+L+FANKQDLP A++ A +T+ L LH ++ R W I  TCA  GEGL+EGLDWLSN +
Sbjct:    1 MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF1_BRARP (ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3)

HSP 1 Score: 239.195 bits (609), Expect = 2.229e-62
Identity = 109/177 (61.58%), Postives = 141/177 (79.66%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT++FS +F  KE RIL++GLD AGKTTILY+L++GE+V+TIPTIGFNVETV+Y NI F VWD+GGQ  IRP WR YF NTQ +I+VVDS+D DR+  A++E H +L E+EL+ AV+L+FANKQDLP A++ A +T+ L LH ++ R W I  TCA  GEGL+EGLDWLSN +
Sbjct:    1 MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEEELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTL 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFJ_DICDI (ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.724e-60
Identity = 104/176 (59.09%), Postives = 139/176 (78.98%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            F+ +FS    KKE RILM+GLD AGK+T+LYKLKLG++V+TIPTIGFNVET+EYKN+S TVWDVGGQ KIRPLW+HY+  +  +IFVVDS DR+R+ E ++E+  +L +DEL+   +LVFANKQD+ NAMN AEI + L L+S++ R WY+Q   A   +G+YEG DW++N++ NK
Sbjct:   13 FSNIFSLFEGKKETRILMIGLDGAGKSTLLYKLKLGDVVSTIPTIGFNVETIEYKNLSMTVWDVGGQHKIRPLWKHYYHGSNAVIFVVDSTDRERMDEVKEEIDNLLIQDELKGTQILVFANKQDMNNAMNTAEIVNSLDLNSIKDRKWYVQPCSAIRSDGIYEGFDWVANSLNNK 188          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFH_DICDI (ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.266e-57
Identity = 102/177 (57.63%), Postives = 138/177 (77.97%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCA-TSGEGLYEGLDWLSNNIANK 631
            F+ +FS    KK+ RILM+GLD AGK+T+LYKLKLG+IV+T+PTIGFNVET+EYKN+S TVWDVGGQ KIR LW+HY+  T  +IFVVDS DR+R+ E ++E+  +L ++EL+   +L+FANKQD+ NAMN +EI D L L+S++ R WY+Q   A  S  G+YEG DW++N++ NK
Sbjct:   13 FSNIFSLFEGKKQTRILMIGLDGAGKSTLLYKLKLGDIVSTVPTIGFNVETIEYKNLSMTVWDVGGQYKIRALWKHYYHGTNAIIFVVDSTDRERMDEVKEEIDTLLIQEELKGIQILIFANKQDMNNAMNTSEIVDSLNLNSIKDRKWYVQPCSAIKSPHGIYEGFDWVANSLNNK 189          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFK_DICDI (ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.159e-57
Identity = 100/176 (56.82%), Postives = 135/176 (76.70%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            F+ +FS    KK+ RILM+GLD AGK+T+L+KLKLG++V TIPTIGFNVET+ YKN+S TVWDVGGQ KIR LW+HY+  T  +IFVVDS DR+R+ E ++E+  +L +DEL+   +LV ANKQD+ NAMN AEI + L L+S++ R WY+Q   A   +G+YEG DW++N++ NK
Sbjct:   13 FSNIFSLFEGKKDTRILMIGLDGAGKSTLLFKLKLGDVVLTIPTIGFNVETIVYKNLSMTVWDVGGQHKIRALWKHYYHGTNAIIFVVDSTDRERMDEVKEEIDNLLIQDELKGIQILVLANKQDMNNAMNTAEIVNSLNLNSIKDRKWYVQPCSAIRSDGIYEGFDWVANSLNNK 188          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL1_HUMAN (ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.021e-55
Identity = 103/180 (57.22%), Postives = 135/180 (75.00%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            MG  F+ +FS LF  +EMRIL++GLD AGKTTILY+L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  ++ EL  ML E+ELR A+L+VFANKQD+  AM ++E+ + LGL +L+ R W I  T AT G GL E ++WL   + ++
Sbjct:    1 MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARF11_CAEEL (ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3)

HSP 1 Score: 216.083 bits (549), Expect = 2.021e-55
Identity = 108/177 (61.02%), Postives = 133/177 (75.14%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MGL F+K+ S +F   E R LM+GLD AGKTTILYKLKL E V TIPTIGFNVETV ++ I+ TVWDVGGQ KIR LW++YF NT  L+FVVDS+D +R+ EA++EL  +L E EL D+ LLVFANKQD+PNA + AE+T  L L SL+ R W+I  T A SG+GLYEGL W+   +
Sbjct:    1 MGLFFSKISSFMFPNIECRTLMLGLDGAGKTTILYKLKLNETVNTIPTIGFNVETVTFQKITLTVWDVGGQKKIRALWKYYFPNTTTLVFVVDSSDIERIPEAKEELFSLLAEPELADSHLLVFANKQDMPNARSPAELTQLLDLGSLKNREWFICGTNAHSGQGLYEGLMWVKKQM 177          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARF3_DROME1.441e-6971.76ADP-ribosylation factor 3 OS=Drosophila melanogast... [more]
ARF4_ARATH7.909e-6867.78Probable ADP-ribosylation factor At2g15310 OS=Arab... [more]
ARF2_SCHPO1.649e-6569.77Probable ADP-ribosylation factor OS=Schizosaccharo... [more]
ARF3_ARATH7.660e-6362.15ADP-ribosylation factor 3 OS=Arabidopsis thaliana ... [more]
ARF1_BRARP2.229e-6261.58ADP-ribosylation factor 1 OS=Brassica rapa subsp. ... [more]
ARFJ_DICDI2.724e-6059.09ADP-ribosylation factor J OS=Dictyostelium discoid... [more]
ARFH_DICDI1.266e-5757.63ADP-ribosylation factor H OS=Dictyostelium discoid... [more]
ARFK_DICDI2.159e-5756.82ADP-ribosylation factor K OS=Dictyostelium discoid... [more]
ARL1_HUMAN2.021e-5557.22ADP-ribosylation factor-like protein 1 OS=Homo sap... [more]
ARF11_CAEEL2.021e-5561.02ADP-ribosylation factor 1-like 1 OS=Caenorhabditis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top