CK933911

Overview
NameCK933911
Unique NameCK933911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933911_ssr27 microsatellite CK933911_ssr27:27..38. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7157 contig Csv1_Contig7157:93..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFD_DICDI (ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 5.694e-50
Identity = 88/177 (49.72%), Postives = 130/177 (73.45%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+S +  FS +F  K +++LM+GLD +GKTTILYKL L E+V+TI T+G+NVET+++K+++ T+WD+ G+++IR LW+ ++     +IFVVDS+DR R+ EA  EL +++ E+EL+   LL+FA KQD  + M   E+TD+LGLH ++ R WY+Q T    G G+YEGLDWLS  I
Sbjct:    1 MGISSSNPFSSIFKSKAIKLLMLGLDGSGKTTILYKLMLNEVVSTISTLGYNVETIQHKHLNLTLWDLAGEERIRTLWKPFYNKCTAIIFVVDSSDRLRIDEAASELAKLMKEEELKGCSLLIFATKQDCISPMEIPELTDQLGLHDIKDRRWYVQPTRTLEGIGIYEGLDWLSTKI 177          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARFF_DICDI (ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.269e-49
Identity = 91/178 (51.12%), Postives = 126/178 (70.79%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRML--NEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANK 631
            F  +FS    K+ +RILM+GLD AGK+T+LYKLK G+++ TIPTIGFNVE +EYKN+S  VWD+GGQ+ IR LWR Y Q T   IFVVDS DR+R  E + E+  ++  N++E  +A LL+FANKQD+ N +  AE+ + L L+SL  + W++Q   A  G+G+YEG DW+ +N + K
Sbjct:   13 FVNIFSLFEGKRNIRILMIGLDGAGKSTLLYKLKFGDVIRTIPTIGFNVEIIEYKNLSMNVWDIGGQNNIRALWRQYDQRTDVFIFVVDSTDRERFDEVKQEIKNIIEQNKNESSNASLLIFANKQDMLNPITPAELVNSLDLNSLTNKKWHVQPCSAVRGDGIYEGFDWIVSNSSGK 190          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5B_MOUSE (ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 3.454e-47
Identity = 90/177 (50.85%), Postives = 127/177 (71.75%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MGL F KL+S LF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +  KN  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   ++EL+RML  ++LR A +L+FANKQD+   M AAEI+  L L S++   W+IQS CA +GEGL +GL+W+++ I
Sbjct:    1 MGLIFAKLWS-LFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRI 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5B_HUMAN (ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 3.454e-47
Identity = 90/177 (50.85%), Postives = 127/177 (71.75%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MGL F KL+S LF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +  KN  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   ++EL+RML  ++LR A +L+FANKQD+   M AAEI+  L L S++   W+IQS CA +GEGL +GL+W+++ I
Sbjct:    1 MGLIFAKLWS-LFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRI 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5A_MOUSE (ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.819e-46
Identity = 86/177 (48.59%), Postives = 126/177 (71.19%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT+++ RLF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +   N  F +WD+GGQ+ +RP W  Y+ NT+ +I VVDS DR+R+   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++   W+IQ+ CA +GEGL +GL+W+ + +
Sbjct:    1 MGILFTRIW-RLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRPSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5A_RAT (ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.233e-45
Identity = 85/177 (48.02%), Postives = 125/177 (70.62%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT+++ RLF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +   N  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++   W+IQ+ CA +GEGL +GL+W+ + +
Sbjct:    1 MGILFTRIW-RLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5A_HUMAN (ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.233e-45
Identity = 85/177 (48.02%), Postives = 125/177 (70.62%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT+++ RLF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +   N  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++   W+IQ+ CA +GEGL +GL+W+ + +
Sbjct:    1 MGILFTRIW-RLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5A_BOVIN (ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.233e-45
Identity = 85/177 (48.02%), Postives = 125/177 (70.62%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MG+ FT+++ RLF  +E ++++VGLD AGKTTILY+  + E+V T PTIG NVE +   N  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++   W+IQ+ CA +GEGL +GL+W+ + +
Sbjct:    1 MGILFTRIW-RLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKGCMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRL 176          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5_DICDI (ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.605e-44
Identity = 81/173 (46.82%), Postives = 123/173 (71.10%), Query Frame = 2
Query:  104 FTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            F  +++R F   E ++++VGL+AAGKTT LYKL L E+V+T PT+G N+E   Y+NI   +WD+GGQD +R  W  Y+ NTQ +I V+DS DR RV   ++EL +ML  + L+ +++L++ANKQDL +AM+  E++  L LHS++   ++IQ+ CA +G+GL  GLDWL ++I
Sbjct:    8 FASIWNRFFNNAEYKVIIVGLNAAGKTTTLYKLLLDEVVSTTPTVGSNLEEFVYRNIRLLMWDLGGQDLLRSTWNQYYINTQAVILVIDSTDRARVNLIKEELFKMLAHENLKKSIILIYANKQDLKDAMSPTELSTLLSLHSIKDHDYHIQACCALTGQGLESGLDWLVSHI 180          
BLAST of CK933911 vs. ExPASy Swiss-Prot
Match: ARL5_CAEEL (ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=2 SV=3)

HSP 1 Score: 178.333 bits (451), Expect = 4.669e-44
Identity = 87/178 (48.88%), Postives = 118/178 (66.29%), Query Frame = 2
Query:   92 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR-QRHWYIQSTCATSGEGLYEGLDWLSNNI 622
            MGL   KLF   +  K+ +I++VGLD AGKTTILY     + V T PTIG NVE V Y+N+ F +WD+GGQ+ +R  W  Y+  T  +I V+DS+D  R+   +++LH ML  ++L  A +LV ANKQDLP AMN AE++ +LGL +LR  R W I   CA  GEGL E L+W++NN+
Sbjct:    1 MGLIMAKLFQSWWIGKKYKIIVVGLDNAGKTTILYNYVTKDQVETKPTIGSNVEEVSYRNLDFVIWDIGGQESLRKSWSTYYVQTDVVIVVIDSSDTTRIPIMKEQLHNMLQHEDLARAHILVLANKQDLPGAMNPAEVSTQLGLQTLRGARKWQINGCCAVKGEGLPEALEWIANNL 178          
The following BLAST results are available for this feature:
BLAST of CK933911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 217
Match NameE-valueIdentityDescription
ARFD_DICDI5.694e-5049.72ADP-ribosylation factor D OS=Dictyostelium discoid... [more]
ARFF_DICDI1.269e-4951.12ADP-ribosylation factor F OS=Dictyostelium discoid... [more]
ARL5B_MOUSE3.454e-4750.85ADP-ribosylation factor-like protein 5B OS=Mus mus... [more]
ARL5B_HUMAN3.454e-4750.85ADP-ribosylation factor-like protein 5B OS=Homo sa... [more]
ARL5A_MOUSE3.819e-4648.59ADP-ribosylation factor-like protein 5A OS=Mus mus... [more]
ARL5A_RAT3.233e-4548.02ADP-ribosylation factor-like protein 5A OS=Rattus ... [more]
ARL5A_HUMAN3.233e-4548.02ADP-ribosylation factor-like protein 5A OS=Homo sa... [more]
ARL5A_BOVIN3.233e-4548.02ADP-ribosylation factor-like protein 5A OS=Bos tau... [more]
ARL5_DICDI1.605e-4446.82ADP-ribosylation factor-like protein 5 OS=Dictyost... [more]
ARL5_CAEEL4.669e-4448.88ADP-ribosylation factor-like protein 5 OS=Caenorha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004543_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10003_IIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933911 ID=CK933911|Name=CK933911|organism=Citrus sinensis|type=EST|length=850bp
GGGGGAAGGACAGCTCTTATTTTTATAGAGAGAGAGAGGGGCAGTAGATC
TGCACCAAGGCAAAAACCGCTCTCTTCCTCAGTCGTGAAAAATGGGGCTG
TCTTTCACCAAGCTTTTCAGCAGGCTTTTTGCTAAGAAAGAGATGAGAAT
TCTCATGGTAGGTCTCGATGCAGCTGGTAAGACTACTATCCTGTACAAGC
TTAAGCTCGGAGAGATCGTCACCACCATTCCTACCATTGGATTTAATGTA
GAGACCGTTGAGTATAAGAACATCAGCTTTACTGTCTGGGATGTCGGGGG
TCAAGACAAGATCCGACCTTTGTGGAGACATTATTTCCAAAACACCCAAG
GACTCATCTTTGTGGTTGACAGTAATGATCGCGACCGTGTGGTAGAAGCT
AGGGATGAGTTGCACAGAATGTTGAATGAGGATGAATTGAGAGATGCTGT
GCTGCTTGTATTTGCTAACAAGCAAGATCTTCCAAATGCAATGAATGCTG
CTGAGATAACTGACAAGCTTGGCCTTCACTCTCTTCGCCAGCGCCACTGG
TATATCCAGAGCACATGTGCCACTTCTGGTGAAGGGCTGTATGAGGGACT
TGACTGGCTCTCAAACAACATTGCAAACAAGGCATAGACAACTAAATTTT
GAGTTTTGGGTTGCCGCAACTGCTGAAATACAGAGTTAACAACACATCTC
AAGTGTTCTCGCTTTCCTTCCTGTAATAGCTTCGTTGCCCGTTTTACTGT
GTTTGTTGTTTCCCTTGCAAACGTTGAGATTTGTTTCTTGTAGCTTCAGA
ATAATTCTTGAATGTTTATCTTTCGAAAAAAAAAAAAAGAAANAAAAAAA
back to top