CK934072

Overview
NameCK934072
Unique NameCK934072
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length544
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_PICSI (S-adenosylmethionine synthetase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.272e-54
Identity = 101/117 (86.32%), Postives = 109/117 (93.16%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKSIVA+GLARRC+VQVSYAIGVPEPLSVFVD+Y TG IPDKEIL ++KENFDFRPGMI INLDLKRGGN RF KTAAYGHFGR+DPDFTWE VKPLK++K Q
Sbjct:  276 TKVDRSGAYIVRQAAKSIVAAGLARRCLVQVSYAIGVPEPLSVFVDSYGTGSIPDKEILELIKENFDFRPGMITINLDLKRGGNGRFQKTAAYGHFGRDDPDFTWETVKPLKWDKAQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK1_BETVU (S-adenosylmethionine synthetase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.272e-54
Identity = 104/117 (88.89%), Postives = 112/117 (95.73%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYI RQAAKSIVASGLARRCIVQ+SYAIGVPEPLSVFVDTY TGKIPDK+IL+IVKE FDFRPGMIAINLDL +GG SR+LKTAAYGHFGR+DPDFTWEVVKPLK++KPQ
Sbjct:  280 TKVDRSGAYIARQAAKSIVASGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKDILKIVKETFDFRPGMIAINLDLLKGG-SRYLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQ 395          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK2_ARATH (S-adenosylmethionine synthetase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.170e-54
Identity = 101/117 (86.32%), Postives = 110/117 (94.02%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKS+VA+G+ARR +VQVSYAIGVPEPLSVFVDTY TG IPDKEIL+IVKE FDFRPGM+ INLDLKRGGN RF KTAAYGHFGR+DPDFTWEVVKPLK++KPQ
Sbjct:  276 TKVDRSGAYIVRQAAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKETFDFRPGMMTINLDLKRGGNGRFQKTAAYGHFGRDDPDFTWEVVKPLKWDKPQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK1_BRAJU (S-adenosylmethionine synthetase 1 OS=Brassica juncea GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.170e-54
Identity = 100/117 (85.47%), Postives = 111/117 (94.87%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQ+AKS+VA+G+ARR +VQVSYAIGVPEP SVFVDTY TG IPDKEIL+IVKE+FDFRPGM+ INLDLKRGGN RFLKTAAYGHFGR+DPDFTWEVVKPLK++KPQ
Sbjct:  276 TKVDRSGAYIVRQSAKSVVANGMARRALVQVSYAIGVPEPFSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK_PINBN (S-adenosylmethionine synthetase OS=Pinus banksiana GN=METK PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.701e-54
Identity = 102/117 (87.18%), Postives = 109/117 (93.16%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVPEPLS+FVDTY TG IPDKEIL I+KE+FDFRPGMI+INLDLKRGGN R  KTAAYGHFGR+DPDFTWE VKPLK+EK Q
Sbjct:  276 TKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSLFVDTYGTGSIPDKEILEIIKEHFDFRPGMISINLDLKRGGNGRSQKTAAYGHFGRDDPDFTWETVKPLKWEKAQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK_MEDFA (S-adenosylmethionine synthetase OS=Medicago falcata GN=SAMS PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 4.833e-54
Identity = 103/112 (91.96%), Postives = 108/112 (96.43%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLK 336
            TKVDRSGAYIVRQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVD+Y TGKIPDKEIL IVKE FDFRPGMI+INLDLKRGGN+RFLKTAAYGHFGR+D DFTWEVVKPLK
Sbjct:  278 TKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILNIVKETFDFRPGMISINLDLKRGGNNRFLKTAAYGHFGRDDADFTWEVVKPLK 389          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK1_TRIMO (S-adenosylmethionine synthetase 1 OS=Triticum monococcum GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 4.833e-54
Identity = 102/115 (88.70%), Postives = 111/115 (96.52%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEK 345
            TKVDRSGAYI RQAAKSI+ASGLARRCIVQ+SYAIGVPEPLSVFVD+Y TGKIPDKEIL+IVKENFDFRPGMI+INLDLK+GGN RF+KTAAYGHFGRED DFTWEVVKPLK++K
Sbjct:  278 TKVDRSGAYIARQAAKSIIASGLARRCIVQISYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKKGGN-RFIKTAAYGHFGREDADFTWEVVKPLKFDK 391          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK4_ARATH (S-adenosylmethionine synthetase 4 OS=Arabidopsis thaliana GN=METK4 PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.313e-54
Identity = 105/117 (89.74%), Postives = 109/117 (93.16%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYIVRQAAKSIVASGLARR IVQVSYAIGVPEPLSVFVD+Y TGKIPDKEIL IVKE+FDFRPGMI+INLDLKRGGN RFLKTAAYGHFGR+D DFTWEVVKPLK  K Q
Sbjct:  276 TKVDRSGAYIVRQAAKSIVASGLARRVIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIVKESFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKSNKVQ 392          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK3_ATRNU (S-adenosylmethionine synthetase 3 OS=Atriplex nummularia GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.077e-53
Identity = 103/117 (88.03%), Postives = 111/117 (94.87%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYI RQAAKSIVA+GLARRCIVQ+SYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKE+FDFRPGMIAINLDL +GG SR+LKTAAYGHFGR+D DFTWE VKPLK+EKPQ
Sbjct:  280 TKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAINLDLLKGG-SRYLKTAAYGHFGRDDADFTWETVKPLKWEKPQ 395          
BLAST of CK934072 vs. ExPASy Swiss-Prot
Match: METK4_ATRNU (S-adenosylmethionine synthetase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.406e-53
Identity = 103/117 (88.03%), Postives = 110/117 (94.02%), Query Frame = 1
Query:    1 TKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYRTGKIPDKEILRIVKENFDFRPGMIAINLDLKRGGNSRFLKTAAYGHFGREDPDFTWEVVKPLKYEKPQ 351
            TKVDRSGAYI RQAAKSIVA+GLARRCIVQ+SYAIGVPEPLSVFVDTY TGKIPDKEIL+IVKE FDFRPGMIAINLDL +GG SR+LKTAAYGHFGR+D DFTWE VKPLK+EKPQ
Sbjct:  280 TKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGG-SRYLKTAAYGHFGRDDADFTWETVKPLKWEKPQ 395          
The following BLAST results are available for this feature:
BLAST of CK934072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_PICSI1.272e-5486.32S-adenosylmethionine synthetase 2 OS=Picea sitchen... [more]
METK1_BETVU1.272e-5488.89S-adenosylmethionine synthetase 1 OS=Beta vulgaris... [more]
METK2_ARATH2.170e-5486.32S-adenosylmethionine synthetase 2 OS=Arabidopsis t... [more]
METK1_BRAJU2.170e-5485.47S-adenosylmethionine synthetase 1 OS=Brassica junc... [more]
METK_PINBN3.701e-5487.18S-adenosylmethionine synthetase OS=Pinus banksiana... [more]
METK_MEDFA4.833e-5491.96S-adenosylmethionine synthetase OS=Medicago falcat... [more]
METK1_TRIMO4.833e-5488.70S-adenosylmethionine synthetase 1 OS=Triticum mono... [more]
METK4_ARATH6.313e-5489.74S-adenosylmethionine synthetase 4 OS=Arabidopsis t... [more]
METK3_ATRNU1.077e-5388.03S-adenosylmethionine synthetase 3 OS=Atriplex numm... [more]
METK4_ATRNU1.406e-5388.03S-adenosylmethionine synthetase 4 OS=Atriplex numm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934072 ID=CK934072|Name=CK934072|organism=Citrus sinensis|type=EST|length=544bp
ACCAAGGTTGATAGAAGTGGTGCTTACATTGTGAGGCAGGCAGCAAAGAG
CATCGTTGCCAGTGGCCTTGCTCGCCGCTGCATTGTGCAGGTTTCTTATG
CTATTGGTGTCCCAGAGCCCCTTTCAGTGTTTGTTGACACTTATCGAACT
GGAAAGATTCCGGACAAGGAGATCCTGAGGATTGTGAAGGAGAACTTTGA
TTTCAGGCCTGGAATGATTGCCATTAACTTGGATCTCAAGAGGGGAGGAA
ATAGCAGGTTTTTGAAGACTGCTGCATATGGGCATTTTGGAAGGGAGGAT
CCTGACTTCACATGGGAGGTGGTGAAGCCCCTCAAGTATGAGAAACCCCA
AGAGTAGTATTTAAGTATGCAGTTTCATTCTTTGTTTGAACTTAATAATT
TACTTGTTCTTTCGTCTGCCTGTCAGATTCTGTCTTTTTTCTCTCTTGGT
CTTGGCCTTTTTTTTTATAAATAAATTTGTATTATCTTTGCCATAATAGA
AAGATATATGTGGCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top