CK934082

Overview
NameCK934082
Unique NameCK934082
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934082_ssr47 microsatellite CK934082_ssr47:47..68. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: ALDH2_RAT (Aldehyde dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh2 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.573e-30
Identity = 66/123 (53.66%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI  VAEG+ ED+D+AV  A+ AF  G PW +M   +R R++ R ADLIE++   LAALET +NGKPYV S   ++ MV++ L YYAGWADK HG T+P DG     T HE
Sbjct:   54 KTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHE 176          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1A2_HUMAN (Retinal dehydrogenase 2 OS=Homo sapiens GN=ALDH1A2 PE=1 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 7.758e-28
Identity = 57/124 (45.97%), Postives = 79/124 (63.71%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGP-WPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G+ FPVY+P T E +  V E D  DID+AV  AR AF  G  W +M   ER R++ + ADL+E++   LA +E+ N GKP++Q+   ++  V++   YYAGWADKIHG+T+P DG     T HE
Sbjct:   52 GRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHE 175          

HSP 2 Score: 24.2534 bits (51), Expect = 7.758e-28
Identity = 9/24 (37.50%), Postives = 17/24 (70.83%), Query Frame = 3
Query:  252 PPVQISYTKNLINGQFVDAASGKM 323
            P ++I YTK  IN ++ ++ SG++
Sbjct:   31 PNLEIKYTKIFINNEWQNSESGRV 54          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1A2_RAT (Retinal dehydrogenase 2 OS=Rattus norvegicus GN=Aldh1a2 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 2.900e-27
Identity = 57/124 (45.97%), Postives = 79/124 (63.71%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGP-WPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G+ FPV +P T E +  V E D  DID+AV  AR AF  G  W +M   ER R++ + ADL+E++   LA +E+ N GKP++Q+   ++  V++ L YYAGWADKIHG+T+P DG     T HE
Sbjct:   52 GRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHE 175          

HSP 2 Score: 24.2534 bits (51), Expect = 2.900e-27
Identity = 9/24 (37.50%), Postives = 17/24 (70.83%), Query Frame = 3
Query:  252 PPVQISYTKNLINGQFVDAASGKM 323
            P ++I YTK  IN ++ ++ SG++
Sbjct:   31 PNLEIKYTKIFINNEWQNSESGRV 54          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1A2_MOUSE (Retinal dehydrogenase 2 OS=Mus musculus GN=Aldh1a2 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 2.900e-27
Identity = 57/124 (45.97%), Postives = 79/124 (63.71%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGP-WPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G+ FPV +P T E +  V E D  DID+AV  AR AF  G  W +M   ER R++ + ADL+E++   LA +E+ N GKP++Q+   ++  V++ L YYAGWADKIHG+T+P DG     T HE
Sbjct:   52 GRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHE 175          

HSP 2 Score: 24.2534 bits (51), Expect = 2.900e-27
Identity = 9/24 (37.50%), Postives = 17/24 (70.83%), Query Frame = 3
Query:  252 PPVQISYTKNLINGQFVDAASGKM 323
            P ++I YTK  IN ++ ++ SG++
Sbjct:   31 PNLEIKYTKIFINNEWQNSESGRV 54          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1B1_HUMAN (Aldehyde dehydrogenase X, mitochondrial OS=Homo sapiens GN=ALDH1B1 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 3.405e-27
Identity = 61/123 (49.59%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI +VAEGD  D+DRAV  AR+AF  G PW +M   ER R++   ADL+E++   LA+LET +NGKP+ +S   ++  V+++  Y+AGWADK HG T+P DG     T HE
Sbjct:   52 KTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHE 174          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1B1_PONAB (Aldehyde dehydrogenase X, mitochondrial OS=Pongo abelii GN=ALDH1B1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.447e-27
Identity = 61/123 (49.59%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI +VAEGD  D+DRAV  AR+AF  G PW +M   ER R++   ADL+E++   LA+LET +NGKP+ +S   ++  V+++  Y+AGWADK HG T+P DG     T HE
Sbjct:   52 KTFPTVNPTTGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNCLADLVERDRVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHE 174          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1B1_MOUSE (Aldehyde dehydrogenase X, mitochondrial OS=Mus musculus GN=Aldh1b1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.447e-27
Identity = 61/123 (49.59%), Postives = 82/123 (66.67%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI +VAEGD  D+D AV  AR+AF  G PW +M   ER R++ R ADL+E++   LA+LET +NGKP+ +S   ++  V+++  Y+AGWADK HG T+P DG     T HE
Sbjct:   54 KTFPTVNPTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHE 176          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1B1_RAT (Aldehyde dehydrogenase X, mitochondrial OS=Rattus norvegicus GN=Aldh1b1 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.294e-26
Identity = 61/123 (49.59%), Postives = 81/123 (65.85%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            KTFP  +P T EVI +VAEGD  D+D AV  AR+AF  G PW +M   ER R++ R ADL+E++   LA+LET +NGKP+ +S   ++  V+++  Y AGWADK HG T+P DG     T HE
Sbjct:   54 KTFPTVNPTTGEVIGHVAEGDRADVDLAVRAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVLDLDEVIKVYRYLAGWADKWHGKTIPMDGEHFCFTRHE 176          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1A2_TAEGU (Retinal dehydrogenase 2 OS=Taeniopygia guttata GN=ALDH1A2 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.837e-26
Identity = 56/124 (45.16%), Postives = 80/124 (64.52%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGP-WPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G+ FPVY+P T E I ++ E D  D D+AV  AR AF  G  W +M   ER  ++ + ADL+E++   LA +E+ N+GKP++Q+   ++  V++ L YYAGWADKIHG+T+P DG     T HE
Sbjct:   52 GRIFPVYNPATGEQICDIQEADKVDTDKAVRAARLAFSLGSVWRRMDASERGHLLDKLADLVERDRAILATMESLNSGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHE 175          

HSP 2 Score: 22.3274 bits (46), Expect = 1.837e-26
Identity = 8/22 (36.36%), Postives = 16/22 (72.73%), Query Frame = 3
Query:  258 VQISYTKNLINGQFVDAASGKM 323
            ++I YTK  IN ++ ++ SG++
Sbjct:   33 LEIKYTKIFINNEWQNSESGRI 54          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: AL1A1_MACFA (Retinal dehydrogenase 1 OS=Macaca fascicularis GN=ALDH1A1 PE=2 SV=3)

HSP 1 Score: 110.538 bits (275), Expect = 1.837e-26
Identity = 56/124 (45.16%), Postives = 76/124 (61.29%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEG-PWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            GK FPV++P T E +  V EGD  D+D+AV  AR+AF  G PW  M   ER R++ + ADLIE++   LA +E+ N GK Y  +  +++   ++ L Y AGWADKI G T+P DG     T HE
Sbjct:   35 GKKFPVFNPATEEELCQVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHE 158          

HSP 2 Score: 28.1054 bits (61), Expect = 1.837e-26
Identity = 13/35 (37.14%), Postives = 23/35 (65.71%), Query Frame = 3
Query:  219 STAAVVEEPIIPP-VQISYTKNLINGQFVDAASGK 320
            S++   + P++P  ++I YTK  IN ++ D+ SGK
Sbjct:    2 SSSGTSDLPVLPTDLKIQYTKIFINNEWHDSVSGK 36          
The following BLAST results are available for this feature:
BLAST of CK934082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 207
Match NameE-valueIdentityDescription
ALDH2_RAT9.573e-3053.66Aldehyde dehydrogenase, mitochondrial OS=Rattus no... [more]
AL1A2_HUMAN7.758e-2845.97Retinal dehydrogenase 2 OS=Homo sapiens GN=ALDH1A2... [more]
AL1A2_RAT2.900e-2745.97Retinal dehydrogenase 2 OS=Rattus norvegicus GN=Al... [more]
AL1A2_MOUSE2.900e-2745.97Retinal dehydrogenase 2 OS=Mus musculus GN=Aldh1a2... [more]
AL1B1_HUMAN3.405e-2749.59Aldehyde dehydrogenase X, mitochondrial OS=Homo sa... [more]
AL1B1_PONAB4.447e-2749.59Aldehyde dehydrogenase X, mitochondrial OS=Pongo a... [more]
AL1B1_MOUSE4.447e-2749.59Aldehyde dehydrogenase X, mitochondrial OS=Mus mus... [more]
AL1B1_RAT1.294e-2649.59Aldehyde dehydrogenase X, mitochondrial OS=Rattus ... [more]
AL1A2_TAEGU1.837e-2645.16Retinal dehydrogenase 2 OS=Taeniopygia guttata GN=... [more]
AL1A1_MACFA1.837e-2645.16Retinal dehydrogenase 1 OS=Macaca fascicularis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F12 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934082 ID=CK934082|Name=CK934082|organism=Citrus sinensis|type=EST|length=769bp
GGGGATGCATGCAGTTGCAAGCTTAACTCGCTAGGACAAAAGTTGCAGAG
AGAGAGAGAGAGAGAGAGAAGAGTTGAATAGGTCGCTTCTTCGCTTTGGC
TATGGCAGCTGCTCGCAGAATCTCCACCTTGCTGTCTCGTTCTTTCCCTT
CTGCTTCTCCTTCTCTGCTTCGCTCTCTTGGTAGGGAGTCTAGCAGGGCA
AGAGGCATCAGCAGGTTTAGCACAGCTGCTGTTGTTGAAGAGCCAATCAT
TCCACCTGTTCAAATTAGTTACACTAAGAATTTAATAAATGGCCAATTTG
TAGACGCAGCATCAGGTAAGATGATTGTTTCCTGATATTTTGGAGCTCAT
TGTTTCTGTTGCTGATAATGAGCCCAATGTTGGAAACTTGTCTGGCCTTA
GGCAAAACATTTCCGGTCTACGACCCTCGTACTGCTGAAGTGATTGCTAA
TGTTGCTGAAGGAGATGCGGAAGATATTGACCGTGCAGTTGCTACTGCTC
GCAAGGCATTTGATGAGGGACCTTGGCCAAAGATGACCCCTTATGAGAGG
TCAAGGATTATGTTGCGGGCTGCTGACTTGATTGAGAAAAACATGGAGGA
GCTGGCAGCTTTGGAGACATGGAACAATGGAAAGCCCTATGTACAATCTC
TCAAATCTGAAGTACCAATGGTGGTTCGCCTGTTGCACTATTATGCTGGA
TGGGCTGATAAAATCCACGGACTAACTGTCCCTGGTGATGGAANNNACCA
TATTCAAACTTTACATGAA
back to top