CK934082

Overview
NameCK934082
Unique NameCK934082
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934082_ssr47 microsatellite CK934082_ssr47:47..68. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_BURM9 (Betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=betB PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 8.406e-18
Identity = 47/111 (42.34%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            GKTF  +DP T E++A V +  A+D+DRAVA+AR+   E  W  MT  +RSRI+ RA +L+ +  + LA LE  + GKP  ++   ++     ++ YYAG A  I GL VP
Sbjct:   21 GKTFDTFDPATGELLARVQQASADDVDRAVASAREGQRE--WAAMTAMQRSRILRRAVELLRERNDALAELEMRDTGKPIAETRAVDIVTGADVIEYYAGLATAIEGLQVP 129          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_BURM7 (Betaine aldehyde dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=betB PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 8.406e-18
Identity = 47/111 (42.34%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            GKTF  +DP T E++A V +  A+D+DRAVA+AR+   E  W  MT  +RSRI+ RA +L+ +  + LA LE  + GKP  ++   ++     ++ YYAG A  I GL VP
Sbjct:   21 GKTFDTFDPATGELLARVQQASADDVDRAVASAREGQRE--WAAMTAMQRSRILRRAVELLRERNDALAELEMRDTGKPIAETRAVDIVTGADVIEYYAGLATAIEGLQVP 129          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_BURPP (Betaine aldehyde dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betB PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.434e-17
Identity = 46/111 (41.44%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            G+TF   DP T E +A+V +  A D+DRAV +A++   E  W  +T  +RSRI+ RA DL+ +  +ELAALET + GKP  ++L  ++     ++ YYAG A  I G  +P
Sbjct:   21 GETFDTLDPATGETLASVQQASAADVDRAVRSAKQGQRE--WAALTAMQRSRILRRAVDLLRERNDELAALETRDTGKPIAETLAVDIVTGADVIEYYAGLATAIEGQQIP 129          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_BURP6 (Betaine aldehyde dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=betB PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.434e-17
Identity = 47/111 (42.34%), Postives = 67/111 (60.36%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            GKTF  +DP T E++A V +  A+D+DRAVA+AR+   E  W  MT  +RSRI+ RA +L+ +    LA LE  + GKP  ++   ++     ++ YYAG A  I GL VP
Sbjct:   21 GKTFDTFDPATGELLARVQQASADDVDRAVASAREGQRE--WAAMTAMQRSRILRRAVELLRERNNALAELEMRDTGKPIAETRAVDIVTGADVIEYYAGLATAIEGLQVP 129          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_XANCP (Betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris GN=betB PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.172e-17
Identity = 50/123 (40.65%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G TF V +P T EV+ANV   DA+D+D AV +A+    +  W  +T  ERSRI+LRA  L+ +  + LA LET N GKP  ++   ++     +L YYAG A  + G+ VP        T HE
Sbjct:   21 GHTFEVVNPATGEVLANVHNADADDLDAAVDSAKAG--QRHWAALTVVERSRILLRAVALLRERNDALAELETLNTGKPLSETRSVDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHE 141          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_XANCB (Betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betB PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.172e-17
Identity = 50/123 (40.65%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G TF V +P T EV+ANV   DA+D+D AV +A+    +  W  +T  ERSRI+LRA  L+ +  + LA LET N GKP  ++   ++     +L YYAG A  + G+ VP        T HE
Sbjct:   21 GHTFEVVNPATGEVLANVHNADADDLDAAVDSAKAG--QRHWAALTVVERSRILLRAVALLRERNDALAELETLNTGKPLSETRSVDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHE 141          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_XANC8 (Betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betB PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.172e-17
Identity = 50/123 (40.65%), Postives = 69/123 (56.10%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G TF V +P T EV+ANV   DA+D+D AV +A+    +  W  +T  ERSRI+LRA  L+ +  + LA LET N GKP  ++   ++     +L YYAG A  + G+ VP        T HE
Sbjct:   21 GHTFEVVNPATGEVLANVHNADADDLDAAVDSAKAG--QRHWAALTVVERSRILLRAVALLRERNDALAELETLNTGKPLSETRSVDIVTGADVLEYYAGVAQALQGVQVPLREGSFFYTRHE 141          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_BURXL (Betaine aldehyde dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betB PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.294e-17
Identity = 43/111 (38.74%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            G+TF   DP T E +A+V +  A D++RAV +AR+   E  W  +T  +RSR++ RA +++ +  +ELAALET + GKP  ++L  ++     ++ YYAG A  I G  +P
Sbjct:   21 GETFDTLDPATGETLASVQQASAADVERAVQSAREGQRE--WAALTAMQRSRVLRRAVEILRERNDELAALETRDTGKPIAETLAVDIATGADVIEYYAGLATAIEGQQIP 129          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: YLX7_SCHPO (Putative aldehyde dehydrogenase-like protein C922.07c OS=Schizosaccharomyces pombe GN=SPAC922.07c PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.704e-16
Identity = 43/110 (39.09%), Postives = 68/110 (61.82%), Query Frame = 2
Query:  404 KTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVP 733
            +T+   DP   EVIA V     ++ID AV +A++AF    W K+   E+  ++++ A+L EK+ + LAA+E  ++GKP V + + +V   + LL Y AGWADKI+G  +P
Sbjct:   34 ETWETVDPSIEEVIAKVYLAGEKEIDYAVKSAKEAFKT--WKKVPGSEKGELLMKLAELTEKHADTLAAIEAMDSGKPLVSNARGDVDGTIALLRYCAGWADKIYGQVIP 141          
BLAST of CK934082 vs. ExPASy Swiss-Prot
Match: BETB_XANC5 (Betaine aldehyde dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betB PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.704e-16
Identity = 50/123 (40.65%), Postives = 67/123 (54.47%), Query Frame = 2
Query:  401 GKTFPVYDPRTAEVIANVAEGDAEDIDRAVATARKAFDEGPWPKMTPYERSRIMLRAADLIEKNMEELAALETWNNGKPYVQSLKSEVPMVVRLLHYYAGWADKIHGLTVPGDGXXHIQTLHE 769
            G TF V +P T EV+ANV    A+D+D AV +A+    +  W  +T  ERSRI+LRA  L+ +  + LA LET N GKP  ++   +V     +L YYAG A  + G  VP        T HE
Sbjct:   21 GHTFEVVNPATGEVLANVHNAGADDLDAAVDSAQAG--QRQWAALTTVERSRILLRAVALLRERNDALAELETLNTGKPLSETRSVDVVTGADVLEYYAGVAQALQGAQVPLREGSFFYTRHE 141          
The following BLAST results are available for this feature:
BLAST of CK934082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 207
Match NameE-valueIdentityDescription
BETB_BURM98.406e-1842.34Betaine aldehyde dehydrogenase OS=Burkholderia mal... [more]
BETB_BURM78.406e-1842.34Betaine aldehyde dehydrogenase OS=Burkholderia mal... [more]
BETB_BURPP1.434e-1741.44Betaine aldehyde dehydrogenase OS=Burkholderia phy... [more]
BETB_BURP61.434e-1742.34Betaine aldehyde dehydrogenase OS=Burkholderia pse... [more]
BETB_XANCP4.172e-1740.65Betaine aldehyde dehydrogenase OS=Xanthomonas camp... [more]
BETB_XANCB4.172e-1740.65Betaine aldehyde dehydrogenase OS=Xanthomonas camp... [more]
BETB_XANC84.172e-1740.65Betaine aldehyde dehydrogenase OS=Xanthomonas camp... [more]
BETB_BURXL9.294e-1738.74Betaine aldehyde dehydrogenase OS=Burkholderia xen... [more]
YLX7_SCHPO2.704e-1639.09Putative aldehyde dehydrogenase-like protein C922.... [more]
BETB_XANC52.704e-1640.65Betaine aldehyde dehydrogenase OS=Xanthomonas camp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_F12 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_F12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934082 ID=CK934082|Name=CK934082|organism=Citrus sinensis|type=EST|length=769bp
GGGGATGCATGCAGTTGCAAGCTTAACTCGCTAGGACAAAAGTTGCAGAG
AGAGAGAGAGAGAGAGAGAAGAGTTGAATAGGTCGCTTCTTCGCTTTGGC
TATGGCAGCTGCTCGCAGAATCTCCACCTTGCTGTCTCGTTCTTTCCCTT
CTGCTTCTCCTTCTCTGCTTCGCTCTCTTGGTAGGGAGTCTAGCAGGGCA
AGAGGCATCAGCAGGTTTAGCACAGCTGCTGTTGTTGAAGAGCCAATCAT
TCCACCTGTTCAAATTAGTTACACTAAGAATTTAATAAATGGCCAATTTG
TAGACGCAGCATCAGGTAAGATGATTGTTTCCTGATATTTTGGAGCTCAT
TGTTTCTGTTGCTGATAATGAGCCCAATGTTGGAAACTTGTCTGGCCTTA
GGCAAAACATTTCCGGTCTACGACCCTCGTACTGCTGAAGTGATTGCTAA
TGTTGCTGAAGGAGATGCGGAAGATATTGACCGTGCAGTTGCTACTGCTC
GCAAGGCATTTGATGAGGGACCTTGGCCAAAGATGACCCCTTATGAGAGG
TCAAGGATTATGTTGCGGGCTGCTGACTTGATTGAGAAAAACATGGAGGA
GCTGGCAGCTTTGGAGACATGGAACAATGGAAAGCCCTATGTACAATCTC
TCAAATCTGAAGTACCAATGGTGGTTCGCCTGTTGCACTATTATGCTGGA
TGGGCTGATAAAATCCACGGACTAACTGTCCCTGGTGATGGAANNNACCA
TATTCAAACTTTACATGAA
back to top