CK934222

Overview
NameCK934222
Unique NameCK934222
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length378
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OLIPU (DNA-directed RNA polymerase subunit beta' OS=Olimarabidopsis pumila GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OENPA (DNA-directed RNA polymerase subunit beta' OS=Oenothera parviflora GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPATHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OENGL (DNA-directed RNA polymerase subunit beta' OS=Oenothera glazioviana GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPATHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OENEH (DNA-directed RNA polymerase subunit beta' OS=Oenothera elata subsp. hookeri GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPATHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OENBI (DNA-directed RNA polymerase subunit beta' OS=Oenothera biennis GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPATHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_OENAR (DNA-directed RNA polymerase subunit beta' OS=Oenothera argillicola GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPATHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_NYMAL (DNA-directed RNA polymerase subunit beta' OS=Nymphaea alba GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_NICTO (DNA-directed RNA polymerase subunit beta' OS=Nicotiana tomentosiformis GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_NICSY (DNA-directed RNA polymerase subunit beta' OS=Nicotiana sylvestris GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_NASOF (DNA-directed RNA polymerase subunit beta' OS=Nasturtium officinale GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
The following BLAST results are available for this feature:
BLAST of CK934222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
RPOC1_OLIPU2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Olima... [more]
RPOC1_OENPA2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Oenot... [more]
RPOC1_OENGL2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Oenot... [more]
RPOC1_OENEH2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Oenot... [more]
RPOC1_OENBI2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Oenot... [more]
RPOC1_OENAR2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Oenot... [more]
RPOC1_NYMAL2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nymph... [more]
RPOC1_NICTO2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nicot... [more]
RPOC1_NICSY2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nicot... [more]
RPOC1_NASOF2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nastu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934222 ID=CK934222|Name=CK934222|organism=Citrus sinensis|type=EST|length=378bp
GCGGGGGGATACATAAAACTGTGGATGCCNNNTAACCCACGTGTGGTATT
TGAAACGTCTTCCTAGTTATATCGCGAATCTTTTAGATAAACCTCTTAAA
GAATTAGAAGGCCTAGTATATTGCGATGTGTGATTTGATCGAAATTTTGA
TTTTACAGATTCGAAATATGAAACTGTCATCCCAGGCAATCGAATTGGGA
TGCCCTGAACCTGACATGTCTCTTTGGAGGAGTCACATGAAGCTCAGACC
GATGGGTGTATTCAATACTCCCCCCAAAAACGAAAAAGGGGAATTGGTCT
ATGGGCGATTCAGTAAAAAATAAATAAGAATTTCTAGTTGTACCTCGTGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top