CK934222

Overview
NameCK934222
Unique NameCK934222
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length378
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_NANDO (DNA-directed RNA polymerase subunit beta' OS=Nandina domestica GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFLFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_MORIN (DNA-directed RNA polymerase subunit beta' OS=Morus indica GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_MANES (DNA-directed RNA polymerase subunit beta' OS=Manihot esculenta GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_LOTJA (DNA-directed RNA polymerase subunit beta' OS=Lotus japonicus GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_LOBMA (DNA-directed RNA polymerase subunit beta' OS=Lobularia maritima GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_LEPVR (DNA-directed RNA polymerase subunit beta' OS=Lepidium virginicum GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_LEMMI (DNA-directed RNA polymerase subunit beta' OS=Lemna minor GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  118 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 156          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_IPOPU (DNA-directed RNA polymerase subunit beta' OS=Ipomoea purpurea GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  118 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 156          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_ILLOL (DNA-directed RNA polymerase subunit beta' OS=Illicium oligandrum GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  118 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 156          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_GOSHI (DNA-directed RNA polymerase subunit beta' OS=Gossypium hirsutum GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
The following BLAST results are available for this feature:
BLAST of CK934222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
RPOC1_NANDO2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nandi... [more]
RPOC1_MORIN2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Morus... [more]
RPOC1_MANES2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Manih... [more]
RPOC1_LOTJA2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Lotus... [more]
RPOC1_LOBMA2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Lobul... [more]
RPOC1_LEPVR2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Lepid... [more]
RPOC1_LEMMI2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Lemna... [more]
RPOC1_IPOPU2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Ipomo... [more]
RPOC1_ILLOL2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Illic... [more]
RPOC1_GOSHI2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Gossy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934222 ID=CK934222|Name=CK934222|organism=Citrus sinensis|type=EST|length=378bp
GCGGGGGGATACATAAAACTGTGGATGCCNNNTAACCCACGTGTGGTATT
TGAAACGTCTTCCTAGTTATATCGCGAATCTTTTAGATAAACCTCTTAAA
GAATTAGAAGGCCTAGTATATTGCGATGTGTGATTTGATCGAAATTTTGA
TTTTACAGATTCGAAATATGAAACTGTCATCCCAGGCAATCGAATTGGGA
TGCCCTGAACCTGACATGTCTCTTTGGAGGAGTCACATGAAGCTCAGACC
GATGGGTGTATTCAATACTCCCCCCAAAAACGAAAAAGGGGAATTGGTCT
ATGGGCGATTCAGTAAAAAATAAATAAGAATTTCTAGTTGTACCTCGTGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top