EY659499

Overview
NameEY659499
Unique NameEY659499
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length922
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7556 contig Csv1_Contig7556:60..983. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_MESAU (Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.848e-43
Identity = 99/243 (40.74%), Postives = 135/243 (55.56%), Query Frame = 1
Query:   70 ADDVVVLTEDNFEKEVGQDRGA-LVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV------------------NNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAF--ALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVS 735
            +DDV+ LT  NF +EV Q     LVEFYAPWCGHC++L PE++K   + K    V +G VD D+H+SL  +YGVQG+PTI+ F     +P+ Y+G R+ EA+ +                     + G      ++   +V+ LT D FD+ VLD     +VEFYAPWCGHCKNL P +   A       +  V +A +DA   + LA +YG+ GFPT+K F KG     +Y GGR   D VS
Sbjct:   24 SDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDV--VKVGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLSGRSGGYSSGKQGRGDSSSKKDVIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWATAATEVKEQTKGKVKLAAVDATVNQVLANRYGIRGFPTIKIFQKGEAP-VDYDGGRTRSDIVS 263          

HSP 2 Score: 82.0333 bits (201), Expect = 5.159e-15
Identity = 43/103 (41.75%), Postives = 61/103 (59.22%), Query Frame = 1
Query:   61 SALADDVVVLTEDNFEKEV-GQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAK--SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRS 360
            S+   DV+ LT+D F+K V   D   +VEFYAPWCGHCK L PE+       K+     V +  VD   ++ L ++YG++G+PTI+ F KG   P  Y+G R+
Sbjct:  156 SSSKKDVIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWATAATEVKEQTKGKVKLAAVDATVNQVLANRYGIRGFPTIKIFQKGE-APVDYDGGRT 257          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA4_CAEEL (Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=2 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 9.975e-43
Identity = 94/227 (41.41%), Postives = 131/227 (57.71%), Query Frame = 1
Query:   73 DDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAF-ALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEK 750
            + VVVLT+ NF+  + ++   LV+FYAPWCGHCK LAPEYEK  +      S+ + KVD      L  ++ +QGYPT++++  G   P  Y+G R    + E+V +    N K    P  VV LT +NFD+ +   ++ VLVEFYAPWCGHCK LAP YEK A    A    V +  +DA   KDL  KYGVSG+PT+K    G +   +Y G R     + ++ ++
Sbjct:   36 EGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKV----SIPLAKVDATVETELGKRFEIQGYPTLKFWKDGK-GPNDYDGGRDEAGIVEWVESRVDPNYK--PPPEEVVTLTTENFDDFI-SNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRR--FDYNGPREAAGIIKYMTDQ 252          

HSP 2 Score: 97.0561 bits (240), Expect = 1.550e-19
Identity = 64/185 (34.59%), Postives = 97/185 (52.43%), Query Frame = 1
Query:  256 EHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGP--RSTEALAEYVNN-EGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAF-ALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK-DGEEYGGGRYLEDFVSFINEKCGTSRDGKGQL 783
            EH  +   Y  + YP         + P +++G    + EA  + +++ +   +VK A  P +    V  +   NFD+IV D+SKDVL+EFYAPWCGHCK+    Y ++A A    + +VV+A +DA    D   ++ V GFPT+ F P G K +  +Y G R LED   F+ +    S   K +L
Sbjct:  444 EHNVVVFGYDGKKYP---------MNPDEFDGELDENLEAFMKQISSGKAKAHVKSAPAPKDDKGPVKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDA-TINDAPSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTKHGVKSFQKKDEL 618          

HSP 3 Score: 76.6406 bits (187), Expect = 2.167e-13
Identity = 41/109 (37.61%), Postives = 64/109 (58.72%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAK-SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNEG 396
            V  +   NF+K V  + +  L+EFYAPWCGHCK    +Y +L  + KK + +V++ K+D   + +  S++ V+G+PTI + P G   EP KY G R  E L +++   G
Sbjct:  501 VKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDA-PSQFAVEGFPTIYFAPAGKKSEPIKYSGNRDLEDLKKFMTKHG 608          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA4_BOVIN (Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.951e-42
Identity = 96/228 (42.11%), Postives = 130/228 (57.02%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKK-AKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALED-DVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            V++L + NF+  V      L+EFYAPWCGHCK+ APEYEK+ A+ K+    + + K+D     +L S++ V GYPTI+   KG  +   YEG R+ E +   V      N      P   +VLT DNFDE+V D +  +LVEFYAPWCGHCK LAP YEK A   +     + +A +DA    DLA+++ VS +PTLK F KG      Y G R     V ++ E+ G
Sbjct:   63 VLILNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIAATLKENDPPIPVAKIDATSESALASRFDVSGYPTIKILKKG--QEVDYEGSRTQEEIVAKVKEVSQPN--WTPPPEVTLVLTKDNFDEVVND-ADIILVEFYAPWCGHCKKLAPEYEKAAKELSKSSPPIPLAKVDAIAETDLAKRFDVSSYPTLKIFRKG--KAFSYNGPREKYGIVDYMMEQSG 283          

HSP 2 Score: 96.2857 bits (238), Expect = 2.643e-19
Identity = 52/147 (35.37%), Postives = 75/147 (51.02%), Query Frame = 1
Query:  325 SLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG--EEYGGGRYLEDFVSFINE 747
            ++EP  ++     + +  +   +    +K   VP N    V V+    FD IV+D  KDVL+EFYAPWCGHCK L P Y  +   +    ++V+A +DA      +++Y V GFPT+ F P G K    +   G R LE    FI E
Sbjct:  485 AMEPDDFDADALRDFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGHKNLVIAKMDATANDVTSDRYKVEGFPTIYFAPSGDKKKPIKFEDGNRDLEHLSKFIEE 631          

HSP 3 Score: 95.1301 bits (235), Expect = 5.889e-19
Identity = 51/132 (38.64%), Postives = 69/132 (52.27%), Query Frame = 1
Query:   82 VVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAK-SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVL 474
            +VLT+DNF++ V      LVEFYAPWCGHCKKLAPEYEK      K+   + + KVD      L  ++ V  YPT++ F KG  +   Y GPR    + +Y+  + G   K       V     D  D I++
Sbjct:  179 LVLTKDNFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKSSPPIPLAKVDAIAETDLAKRFDVSSYPTLKIFRKG--KAFSYNGPREKYGIVDYMMEQSGPPSKQILALKQVQEFLKDGDDVIII 308          

HSP 4 Score: 79.7221 bits (195), Expect = 2.560e-14
Identity = 37/88 (42.05%), Postives = 56/88 (63.64%), Query Frame = 1
Query:  127 RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYE-GPRSTEALAEYV 384
            +  L+EFYAPWCGHCK+L P Y  LG  +K  K+++I K+D   +     +Y V+G+PTI + P G   +P K+E G R  E L++++
Sbjct:  542 KDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGHKNLVIAKMDATANDVTSDRYKVEGFPTIYFAPSGDKKKPIKFEDGNRDLEHLSKFI 629          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA6_CAEEL (Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.440e-41
Identity = 107/273 (39.19%), Postives = 154/273 (56.41%), Query Frame = 1
Query:   22 IWLALSTLTLFFVSAL---ADDVVVLTEDNFE-KEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNE---------GGTNVKIAAVPSN--------------VVVLTADNFDEIVLDKSKDV-LVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGH--KDGEEYGGGRYLEDFVSFINEK 750
            I L L++L +  V  +    DDVV LTE NF+ K +  D   +VEFYAPWCGHCK L PEY+K  ++ K    V  G VD  +H+S+   Y VQG+PT++ F     +P  Y G R+ +A+A+ V  E         GG +   ++  S               VV LT  NF+++VL+ SKD+ LVEF+APWCGHCK+L P ++  AAA  L+  V +  LDA  +  +A K+ + GFPT+K+F  G    D ++Y GGR   D V++ + +
Sbjct:    4 IKLLLASLAITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGVAKV--GAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLN-SKDIWLVEFFAPWCGHCKSLEPQWK--AAASELKGKVRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASAR 271          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: TXND5_MOUSE (Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.881e-41
Identity = 93/235 (39.57%), Postives = 138/235 (58.72%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNN------------EGGTNVKIAAVPS----NVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVA-AAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFI 741
            L+ +NFE  V Q     ++F+APWCGHCK LAP +E+L    + +++V IGKVDC +H ++CS++ V+GYPT+ WF  G  +  +Y+G R  E+L +YV +            E      +AA P+     V+ LT  +F++ +        V+FYAPWCGHCKNLAPT+E+++   F    DV +A +D    +++  KY V G+PTL  F  G K G E+ GGR L+   SF+
Sbjct:  180 LSANNFELHVSQGNH-FIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGK-KVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGI--TFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVG-EHNGGRDLDSLHSFV 409          

HSP 2 Score: 138.658 bits (348), Expect = 4.644e-32
Identity = 80/232 (34.48%), Postives = 122/232 (52.59%), Query Frame = 1
Query:   91 TEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAK--SVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEY----VNNEGGTNVKIAAVP------SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEK 750
            T D F   + Q     V F+APWCGHC++L P +  LG  +   +   V + KVDC     +CS  GV+GYPT+++F  G  E  KY+GPR  E L  +    +N E  T    A  P        +  L+A+NF+  V     +  ++F+APWCGHCK LAPT+E++A      + V +  +D  ++  +  ++ V G+PTL +F  G K  ++Y G R LE    ++  +
Sbjct:   53 TADMFTHGI-QSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQ-EAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHV--SQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDG-KKVDQYKGKRDLESLRDYVQSQ 279          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA4_HUMAN (Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 4.191e-41
Identity = 96/228 (42.11%), Postives = 129/228 (56.58%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFK-KAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALED-DVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            V+VL + NF+  V      L+EFYAPWCGHCK+ APEYEK+    K K   + + K+D      L S++ V GYPTI+   KG  +   YEG R+ E +   V     +       P   +VLT +NFDE+V D +  +LVEFYAPWCGHCK LAP YEK A   +     + +A +DA    DLA+++ VSG+PTLK F KG     +Y G R     V ++ E+ G
Sbjct:   64 VLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKG--QAVDYEGSRTQEEIVAKVREV--SQPDWTPPPEVTLVLTKENFDEVVND-ADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRP--YDYNGPREKYGIVDYMIEQSG 284          

HSP 2 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  319 KGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG--EEYGGGRYLEDFVSFINE 747
            K ++EP++++     E +  +   +    +K   VP N    V V+    FD IV+D  KDVL+EFYAPWCGHCK L P Y  +A  +  +  +V+A +DA      +++Y V GFPT+ F P G K    +  GG R LE    FI E
Sbjct:  485 KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEE 633          

HSP 3 Score: 101.293 bits (251), Expect = 8.217e-21
Identity = 57/158 (36.08%), Postives = 78/158 (49.37%), Query Frame = 1
Query:   82 VVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF-KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYE 552
            +VLT++NF++ V      LVEFYAPWCGHCKKLAPEYEK      K++  + + KVD      L  ++ V GYPT++ F KG   P  Y GPR    + +Y+  + G   K       V     D  D I++   K      Y  +     NL   Y+
Sbjct:  180 LVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKG--RPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYK 335          

HSP 4 Score: 77.7962 bits (190), Expect = 9.729e-14
Identity = 36/88 (40.91%), Postives = 54/88 (61.36%), Query Frame = 1
Query:  127 RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYE-GPRSTEALAEYV 384
            +  L+EFYAPWCGHCK+L P Y  L   +K  K ++I K+D   +     +Y V+G+PTI + P G  + P K+E G R  E L++++
Sbjct:  544 KDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFI 631          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA4_RAT (Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 9.337e-41
Identity = 92/228 (40.35%), Postives = 130/228 (57.02%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFK-KAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALED-DVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            V VL ++NF+  V      L+EFYAPWCGHCK+ APEYEK+ ++ K     + + K+D      L SK+ V GYPTI+   KG  +   Y+G R+ E +   V     +       P   + LT +NFD++V + +  +LVEFYAPWCGHCK LAP YEK A   +     + +A +DA +  DLA+++ VSG+PTLK F KG     +Y G R     V ++ E+ G
Sbjct:   62 VWVLNDENFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKG--QAVDYDGSRTQEEIVAKVREV--SQPDWTPPPEVTLTLTKENFDDVV-NNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRP--FDYNGPREKYGIVDYMVEQSG 282          

HSP 2 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  319 KGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG--EEYGGGRYLEDFVSFINE 747
            K ++EP++++     E +  +   +    +K   VP N    V V+    FD IV+D  KDVL+EFYAPWCGHCK L P Y  +   +  + D+V+A +DA       ++Y V GFPT+ F P G K    +  GG R LE    FI+E
Sbjct:  483 KFAMEPEEFDSDALQEFVMAFKKGKLKPVIKSQPVPKNNKGPVRVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDE 631          

HSP 3 Score: 99.3673 bits (246), Expect = 3.123e-20
Identity = 52/132 (39.39%), Postives = 70/132 (53.03%), Query Frame = 1
Query:   82 VVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF-KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVL 474
            + LT++NF+  V      LVEFYAPWCGHCKKLAPEYEK      K++  + + KVD  E   L  ++ V GYPT++ F KG   P  Y GPR    + +Y+  + G   K       V     D  D ++L
Sbjct:  178 LTLTKENFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKG--RPFDYNGPREKYGIVDYMVEQSGPPSKEILTLKQVQEFLKDGDDVVIL 307          

HSP 4 Score: 79.337 bits (194), Expect = 3.344e-14
Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  127 RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYE-GPRSTEALAEYVN 387
            +  L+EFYAPWCGHCK+L P Y  LG  +K  K ++I K+D   +     +Y V+G+PTI + P G  + P K+E G R  E L+++++
Sbjct:  542 KDVLIEFYAPWCGHCKQLEPVYTSLGKKYKGQKDLVIAKMDATANDITNDRYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFID 630          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA4_MOUSE (Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.219e-40
Identity = 93/228 (40.79%), Postives = 129/228 (56.58%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFK-KAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALED-DVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCG 756
            V VL + NF+  V      L+EFYAPWCGHCK+ APEYEK+ ++ K     + + K+D      L SK+ V GYPTI+   KG  +   Y+G R+ E +   V     +       P   + LT DNFD++V + +  +LVEFYAPWCGHCK LAP YEK A   +     + +A +DA +  DLA+++ VSG+PTLK F KG     +Y G R     V ++ E+ G
Sbjct:   57 VWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKG--QAVDYDGSRTQEEIVAKVREV--SQPDWTPPPEVTLSLTKDNFDDVV-NNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRP--FDYNGPREKYGIVDYMIEQSG 277          

HSP 2 Score: 103.99 bits (258), Expect = 1.268e-21
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  319 KGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSN----VVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDG--EEYGGGRYLEDFVSFINE 747
            K ++EP++++     E +  +   +    +K   VP N    V V+    FD IV+D  KDVL+EFYAPWCGHCK L P Y  +   +  + D+V+A +DA       ++Y V GFPT+ F P G K    +  GG R LE    FI+E
Sbjct:  478 KFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDE 626          

HSP 3 Score: 100.523 bits (249), Expect = 1.402e-20
Identity = 54/141 (38.30%), Postives = 74/141 (52.48%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF-KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFY 507
            LT+DNF+  V      LVEFYAPWCGHCKKLAPEYEK      K++  + + KVD  E   L  ++ V GYPT++ F KG   P  Y GPR    + +Y+  + G        P +  +LT     E + D    V++  +
Sbjct:  175 LTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKG--RPFDYNGPREKYGIVDYMIEQSG--------PPSKEILTLKQVQEFLKDGDDVVIIGLF 305          

HSP 4 Score: 78.5666 bits (192), Expect = 5.704e-14
Identity = 37/89 (41.57%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  127 RGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYE-GPRSTEALAEYVN 387
            +  L+EFYAPWCGHCK+L P Y  LG  +K  K ++I K+D   +     +Y V+G+PTI + P G  + P K+E G R  E L+++++
Sbjct:  537 KDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFID 625          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: TXND5_HUMAN (Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 6.052e-40
Identity = 93/236 (39.41%), Postives = 134/236 (56.78%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNE------GGTNV-------KIAAVP----SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVA-AAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFI 741
            L+  NFE  V Q     ++F+APWCGHCK LAP +E+L    + +++V IGKVDC +H  LCS   V+GYPT+ WF  G  +  +Y+G R  E+L EYV ++      G T          +AA P      V+ LT +NFD+ + +      ++FYAPWCGHCK LAPT+E+++   F     V +A +D    +++  KY V G+PTL  F +G K   E+ GGR L+    F+
Sbjct:  194 LSASNFELHVAQG-DHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGK-KVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFDDTIAEGI--TFIKFYAPWCGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLF-RGGKKVSEHSGGRDLDSLHRFV 424          

HSP 2 Score: 140.584 bits (353), Expect = 1.222e-32
Identity = 83/239 (34.73%), Postives = 122/239 (51.05%), Query Frame = 1
Query:   91 TEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKS--VLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEY----VNNEGGTNVKIAAVPS------NVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDADKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFINEKCGTSRDG 771
            T D F   + Q     V F+APWCGHC++L P +  LG  +   +   V + KVDC  H  +CS  GV+GYPT++ F  G  E  KY+GPR  + L  +    +N E  T       PS       +  L+A NF+  V     D  ++F+APWCGHCK LAPT+E++A      + V +  +D  ++ +L     V G+PTL +F  G K  ++Y G R LE    ++  +   +  G
Sbjct:   67 TADMFTHGI-QSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTAHSDVCSAQGVRGYPTLKLFKPGQ-EAVKYQGPRDFQTLENWMLQTLNEEPVTPEPEVEPPSAPELKQGLYELSASNFELHV--AQGDHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDG-KKVDQYKGKRDLESLREYVESQLQRTETG 300          
BLAST of EY659499 vs. ExPASy Swiss-Prot
Match: PDIA5_HUMAN (Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.071e-28
Identity = 80/216 (37.04%), Postives = 123/216 (56.94%), Query Frame = 1
Query:   70 ADDVVVL-TEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIG-KVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVP-----SNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDV--VVANLDADKYKDLAEKYGVSGFPTLKFFPKGHK 687
            A DVV L +E +F + +  +++  L+ FYAPWC  CK++ P ++K  A+  +  +VL G  V   E +++  +Y V+G+PTI +F KG    +      + E + E++ N      ++   P      +V  LT ++FD+ V + S  VLV F+APWCGHCK + P +EK A A   E D   V+A +DA   K LAE++ +S FPTLK+F  G K
Sbjct:  150 AKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQK-AATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHS-SVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEK 363          

HSP 2 Score: 126.331 bits (316), Expect = 2.385e-28
Identity = 76/227 (33.48%), Postives = 120/227 (52.86%), Query Frame = 1
Query:   88 LTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASF--KKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGP--RSTEALAEYVNNEGGT---NVKIAAVPSNVVVLTADNFDEIVLDKSKDVLVEFYAPWCGHCKNLAPTYEKVAAAFALEDDVVVANLDA--DKYKDLAEKYGVSGFPTLKFFPKGHKDGEEYGGGRYLEDFVSFI 741
            LT+++F++ V +    LV F+APWCGHCKK+ PE+EK   +   +   S ++  VD   +K+L  ++ +  +PT+++F  G    +KY  P  R+ +   E++ N               ++V+ L  DNF E  L K K  LV FYAPWC HCK + P +   A AF  +  +  A +D   DK +DL ++  V G+PT  ++  G K  E+Y   R    F ++I
Sbjct:  281 LTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNG----EKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRE-TLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYG-KFAEKYDSDRTELGFTNYI 501          

HSP 3 Score: 77.411 bits (189), Expect = 1.271e-13
Identity = 36/104 (34.62%), Postives = 57/104 (54.81%), Query Frame = 1
Query:   79 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIGKVDC--DEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYV 384
            V+ L  DNF + + + +  LV FYAPWC HCKK+ P +     +FK  + +    VDC  D+++ LC +  V+GYPT  ++  G    +KY+  R+      Y+
Sbjct:  399 VLHLVGDNFRETLKKKKHTLVMFYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKF-AEKYDSDRTELGFTNYI 501          
The following BLAST results are available for this feature:
BLAST of EY659499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
PDIA6_MESAU5.848e-4340.74Protein disulfide-isomerase A6 OS=Mesocricetus aur... [more]
PDIA4_CAEEL9.975e-4341.41Probable protein disulfide-isomerase A4 OS=Caenorh... [more]
PDIA4_BOVIN4.951e-4242.11Protein disulfide-isomerase A4 OS=Bos taurus GN=PD... [more]
PDIA6_CAEEL1.440e-4139.19Probable protein disulfide-isomerase A6 OS=Caenorh... [more]
TXND5_MOUSE1.881e-4139.57Thioredoxin domain-containing protein 5 OS=Mus mus... [more]
PDIA4_HUMAN4.191e-4142.11Protein disulfide-isomerase A4 OS=Homo sapiens GN=... [more]
PDIA4_RAT9.337e-4140.35Protein disulfide-isomerase A4 OS=Rattus norvegicu... [more]
PDIA4_MOUSE1.219e-4040.79Protein disulfide-isomerase A4 OS=Mus musculus GN=... [more]
TXND5_HUMAN6.052e-4039.41Thioredoxin domain-containing protein 5 OS=Homo sa... [more]
PDIA5_HUMAN1.071e-2837.04Protein disulfide-isomerase A5 OS=Homo sapiens GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-009-G10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659499 ID=EY659499|Name=EY659499|organism=Citrus sinensis|type=EST|length=922bp
ANAGATATTGAGAGGTATCAGATCTGGCTAGCTCTCAGCACTTTAACCTT
GTTCTTCGTATCAGCTCTAGCGGACGATGTCGTTGTGCTAACAGAAGACA
ACTTCGAGAAGGAGGTTGGTCAGGACAGGGGAGCTCTTGTTGAGTTTTAC
GCTCCTTGGTGTGGCCACTGTAAAAAGCTTGCTCCAGAGTATGAGAAACT
TGGTGCAAGCTTTAAGAAAGCAAAGTCTGTCTTGATTGGAAAGGTGGACT
GTGACGAGCATAAGAGCTTATGCAGCAAATATGGTGTTCAAGGATACCCA
ACAATTCAATGGTTTCCTAAAGGTTCTTTGGAACCCAAAAAGTATGAAGG
GCCACGATCTACTGAAGCCCTTGCTGAGTATGTGAATAATGAAGGAGGAA
CCAATGTGAAGATAGCTGCAGTCCCATCCAATGTGGTGGTACTAACAGCT
GATAATTTTGATGAGATAGTTTTGGACAAAAGCAAAGATGTTTTGGTTGA
ATTTTATGCACCATGGTGTGGCCATTGCAAAAACCTTGCGCCTACATATG
AAAAGGTGGCAGCCGCATTTGCATTGGAAGATGATGTAGTCGTTGCTAAT
TTGGATGCTGACAAATACAAGGATCTGGCTGAGAAGTATGGAGTTAGTGG
ATTTCCTACATTGAAGTTCTTTCCAAAAGGGCACAAAGATGGTGAGGAAT
ATGGGGGTGGCAGATATTTGGAAGACTTTGTTTCTTTCATCAATGAAAAA
TGTGGCACCAGTCGTGATGGAAAAGGACAACTTACTTCAACGGNGGTATA
GTTGCGAGCTTAAAGCCTNGGTGAAAGGATTTGTTGCTGCTACCGGTGAT
GAAAAAAGGCAGTCTTCTCAANATTGACCGGGAGTTTGAGTGCTTGAGGC
TCCACTGCGGCATGGGAAGATT
back to top